DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and hng3

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_612057.1 Gene:hng3 / 38090 FlyBaseID:FBgn0035160 Length:333 Species:Drosophila melanogaster


Alignment Length:305 Identity:69/305 - (22%)
Similarity:114/305 - (37%) Gaps:59/305 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLRSLK----L 77
            |.:..|:.:..||:..||.::.:.:.||.|..||......|..||.:|:.:|.|:.||.:    |
  Fly     5 RLIFEVQQRRALWDARHPDHANRPETQRLWNAVAEATGMDVELCRTKWKNLRCSYRRSNRRSGIL 69

  Fly    78 ARTQTGRGKRKYYLSKYLQFLVPFTKSRSCHKQLPGMVLRKPGQAATAQQEDEVVAAEEEAKVSD 142
            ...|:.....::..::.:.||  ..:...|.....|              |:|:   |...|:..
  Fly    70 KHQQSPSPGHQWSYAEAMSFL--DGQREECDNSNNG--------------EEEM---ESALKIEA 115

  Fly   143 GEMPL-------DVQVSEEEHRRNQEQDREQPTACLP---------LRLHSIKVEHDSSNANQQL 191
            ..||:       .|..::|....|....||......|         :.|.|...|....:...||
  Fly   116 EHMPMLSTFKSEQVSAADEMEADNDALMREFQNVSTPQALRRLSENISLASAAAEEQVPSTADQL 180

  Fly   192 ERMVSQQSLVSVPAAALGNHLG--WSDLTQWFKGHGSGHHKLTTTTTTPTSPPPPPQPATSALSV 254
            ...::|.|.::. |||...|..  ..:...:.:.......:|..:|:         |......||
  Fly   181 SPNLNQGSAIAA-AAASSCHCAKRVDEQVNFLESLEREEQQLMQSTS---------QDLARCKSV 235

  Fly   255 FTGGPGGGGSQPDADYSFLISLHPYIKEMNGKQNRKFRQKVVGLI 299
            ...|        |:||::|||..|.:|:|...||..||.|:..|:
  Fly   236 LHVG--------DSDYNYLISFLPLMKQMTPFQNVFFRAKMGELL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 23/89 (26%)
BESS 267..301 CDD:281011 15/33 (45%)
hng3NP_612057.1 MADF 5..91 CDD:214738 23/87 (26%)
BESS 240..274 CDD:281011 15/33 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.