DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and CG13204

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_610678.1 Gene:CG13204 / 36227 FlyBaseID:FBgn0033627 Length:605 Species:Drosophila melanogaster


Alignment Length:276 Identity:54/276 - (19%)
Similarity:97/276 - (35%) Gaps:87/276 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLRSLKLARTQT 82
            |::.|:....::|..:|.|...|...:.|.|:|::|..:|...:.:|:.:|.|:.:.|:..|..|
  Fly    23 FIEIVKKYDVVYNNHNPDYKNVEVKLKVWTQIADEIGLSVEASKRKWKNLRDSYTKYLRSFRVGT 87

  Fly    83 GRGKRKYYL--SKYLQFLVPFTKSRSCHKQLPGMVLRKPGQAATAQQED-------EVVAAEEEA 138
            ...|:..|.  :.::.||.||        |.||..... |...:..::|       :|:|   :|
  Fly    88 KTSKKYQYWAHADHMDFLKPF--------QGPGRNSAN-GNGKSNDEDDTECDFGYQVLA---KA 140

  Fly   139 KVSDGEMPLDVQVSEEEHRRNQEQDREQPTACLPLRLHSIKVEHDSSNANQQLERMVSQQSLVSV 203
            ..:.||..|.:.::...            ..|..:..|::.               ....:|.|.
  Fly   141 ASNGGEDELKITIATAS------------AGCSSMGTHTVN---------------TYTTALSST 178

  Fly   204 PAAALGNHLGWSDLTQWFKGHGSGHHKLTTTTTTPTSPPPPPQPATSALSVFTGGPGGGGSQPDA 268
            .|:.:.:.||                        .|:||....|.::     .||.|||..    
  Fly   179 SASGITSSLG------------------------ATTPPNMISPGSN-----LGGTGGGSG---- 210

  Fly   269 DYSFLISLHPYIKEMN 284
                  |:.|.|...|
  Fly   211 ------SVGPQIHNSN 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 23/86 (27%)
BESS 267..301 CDD:281011 4/18 (22%)
CG13204NP_610678.1 MADF 22..108 CDD:214738 21/84 (25%)
BESS 478..510 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.