DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and AgaP_AGAP005077

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_558466.3 Gene:AgaP_AGAP005077 / 3289897 VectorBaseID:AGAP005077 Length:349 Species:Anopheles gambiae


Alignment Length:200 Identity:51/200 - (25%)
Similarity:82/200 - (41%) Gaps:34/200 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLRSLKLARTQTG 83
            :||::..|.|||...|.|..|:....||:.::.::...|...|.:|.:::|||...|.|  .|.|
Mosquito    85 IQFIQAIPYLWNSNDPLYKNKKSQAEAWESISEEMGVPVPELRHKWASLQSSFRHFLVL--YQKG 147

  Fly    84 RGK----------RKYYLSKYLQFLVPFTKSRSCHKQLPGMVLRKPGQAATAQQEDEVVAAEE-- 136
            |..          |::||...:.||:...|.|:     |...:.|....:|...:..:.|...  
Mosquito   148 RASQNCEGGQLPLRRWYLYDDMLFLLASGKERT-----PERKVIKQNNYSTEDMDQSMDAVSHLA 207

  Fly   137 EAKVSDGEMPLDVQVSEEEHRRNQEQDREQP----TACLPLRLHSIKVEHDSSNANQQ---LERM 194
            :.|.:.|.       |.|...:|..|....|    .:..|:| ..||.:|.||...:|   .:|.
Mosquito   208 DTKTTTGN-------SLEMSGQNPIQRTVPPPWAAVSRTPIR-KQIKSQHVSSVVVRQDLYAKRK 264

  Fly   195 VSQQS 199
            |..|:
Mosquito   265 VMYQT 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 27/93 (29%)
BESS 267..301 CDD:281011
AgaP_AGAP005077XP_558466.3 MADF_DNA_bdg 84..172 CDD:287510 25/88 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.