DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and LOC3289897

DIOPT Version :10

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_558466.4 Gene:LOC3289897 / 3289897 VectorBaseID:AGAMI1_004322 Length:349 Species:Anopheles gambiae


Alignment Length:200 Identity:51/200 - (25%)
Similarity:83/200 - (41%) Gaps:34/200 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLRSLKLARTQTG 83
            :||::..|.|||...|.|..|:....||:.::.::...|...|.:|.:::|||...|.|  .|.|
Mosquito    85 IQFIQAIPYLWNSNDPLYKNKKSQAEAWESISEEMGVPVPELRHKWASLQSSFRHFLVL--YQKG 147

  Fly    84 RG----------KRKYYLSKYLQFLVPFTKSRSCHKQLPGMVLRKPGQAATAQQEDEVVAAEE-- 136
            |.          :|::||...:.||:...|.|:     |...:.|....:|...:..:.|...  
Mosquito   148 RASQHCEGGELPRRRWYLYDDMLFLLASGKERT-----PERTVIKQNNDSTEDMDQSMDAVSHLA 207

  Fly   137 EAKVSDGEMPLDVQVSEEEHRRNQEQDREQP----TACLPLRLHSIKVEHDSSNANQQ---LERM 194
            :.|.:.|.       |.|...:|..|....|    .:..|:| ..||.:|.||...:|   .:|.
Mosquito   208 DTKTATGN-------SLEMSGQNPIQRTVPPPWAAVSRTPIR-KQIKSQHVSSVVVRQDLYAKRK 264

  Fly   195 VSQQS 199
            |..|:
Mosquito   265 VMYQT 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 27/93 (29%)
BESS 267..301 CDD:460758
LOC3289897XP_558466.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.