DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and CG12609

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_728194.1 Gene:CG12609 / 32862 FlyBaseID:FBgn0030952 Length:324 Species:Drosophila melanogaster


Alignment Length:323 Identity:66/323 - (20%)
Similarity:111/323 - (34%) Gaps:126/323 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FNVRFVQFVENQPCLWNYTHPGYSKKEDVQR-AWQQVAND---------IKDTVRNCRERWRTIR 68
            ||:|.|.....|||||..|.|.| |..|::| :|:::|:.         |:..:||.|.:....:
  Fly    31 FNLRLVDLYREQPCLWKITLPAY-KDADMKRSSWEKIASQLGSHLSAEFIRCRMRNMRYQLNVYK 94

  Fly    69 SSFLRSLKLARTQTGRGK---RKYYLSKYLQFL----------------------VP----FTKS 104
               |:.::...| :|:||   :.||:.:: .||                      :|    |.|.
  Fly    95 ---LQMIEYQMT-SGKGKPPEKPYYVDRF-AFLEQEDGAEESDNQQSNANAKKQNIPRSERFAKL 154

  Fly   105 RSCHKQLPGMVLRKPGQAA------TAQQEDEVVAAEEEAKVSD--------------------- 142
            .| ...|..|..|:...|:      :.|:..::|....:|:|..                     
  Fly   155 WS-DFNLKSMTKRESTDASSKESHRSGQRIADMVKMRMDAQVGPLAFDRPRLKIPDFKQNIIWKR 218

  Fly   143 --GEMPLDVQV----------------SEEEHRRNQEQ-DREQPTACLPLRLHSIKVEHDSSNAN 188
              |....|..|                |..:.:.||:. |.||||..   |:....:.:|..:.:
  Fly   219 NLGNRSSDTSVGDLSETLSTLQARPGDSVSKTKMNQKDLDSEQPTTS---RMAKYALANDGQSED 280

  Fly   189 QQLERM-----VSQQSLVSVPAAALGNHLGWSDLTQWFKGHGSGHHKL--TTTTTTPTSPPPP 244
            ::|.:|     ..|:||                        ..||.:.  ..|.:.|:.|..|
  Fly   281 EELYKMHWKVRTGQRSL------------------------RPGHDRCQKLPTLSLPSKPDEP 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 30/124 (24%)
BESS 267..301 CDD:281011
CG12609NP_728194.1 MADF_DNA_bdg 35..122 CDD:287510 25/92 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.