DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and CG15601

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_573058.1 Gene:CG15601 / 32509 FlyBaseID:FBgn0030673 Length:277 Species:Drosophila melanogaster


Alignment Length:245 Identity:54/245 - (22%)
Similarity:99/245 - (40%) Gaps:54/245 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MARKDD---PVFNVRFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKD---TVRNCRERW 64
            |::..|   |:  ..|::....||||:|.....|..:...:.|:..:...:|.   ||.:.:.:.
  Fly     1 MSKLSDTKIPI--TEFLEAYRRQPCLYNTLLDSYKNRVSREEAYGAIIRSLKIPQLTVSDIKLKI 63

  Fly    65 RTIRSSFLRSLKLARTQTGRGKRKYYLSKYLQFLV--PFTKSRS---CHKQLPGMVLRKPGQAAT 124
            :::|:.:.:.|::...:...|:.  |..|...|.:  .|.:|.|   |.:|  |.......|..|
  Fly    64 KSVRTVYSKELRIWMREKELGRT--YEPKLFWFRLADSFLRSVSLSHCKRQ--GKNNSSSAQLTT 124

  Fly   125 AQQED---------------EVVAAEEEAKVS--DGEMPLDVQVSEEEHRRNQEQDREQPTACLP 172
            .:.::               |....||:|:|:  ..|.||      ||.|......::..|.|| 
  Fly   125 IKSDETSKLLCTAAADITMSEDALEEEDAEVNGEPEECPL------EESRPTASICKDDSTLCL- 182

  Fly   173 LRLHSIKVEHDSS--NANQQLERMVSQQS---LVSVPAAALGNHLGWSDL 217
              ....:.||.|.  :::|||...::|:.   :.|:.:|      |..||
  Fly   183 --ADQPQQEHYSQGCSSSQQLPHTMAQRKSKYITSLDSA------GEDDL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 18/90 (20%)
BESS 267..301 CDD:281011
CG15601NP_573058.1 MADF_DNA_bdg 14..101 CDD:287510 17/88 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.