DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and CG15601

DIOPT Version :10

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_573058.1 Gene:CG15601 / 32509 FlyBaseID:FBgn0030673 Length:277 Species:Drosophila melanogaster


Alignment Length:245 Identity:54/245 - (22%)
Similarity:99/245 - (40%) Gaps:54/245 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MARKDD---PVFNVRFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKD---TVRNCRERW 64
            |::..|   |:  ..|::....||||:|.....|..:...:.|:..:...:|.   ||.:.:.:.
  Fly     1 MSKLSDTKIPI--TEFLEAYRRQPCLYNTLLDSYKNRVSREEAYGAIIRSLKIPQLTVSDIKLKI 63

  Fly    65 RTIRSSFLRSLKLARTQTGRGKRKYYLSKYLQFLV--PFTKSRS---CHKQLPGMVLRKPGQAAT 124
            :::|:.:.:.|::...:...|:.  |..|...|.:  .|.:|.|   |.:|  |.......|..|
  Fly    64 KSVRTVYSKELRIWMREKELGRT--YEPKLFWFRLADSFLRSVSLSHCKRQ--GKNNSSSAQLTT 124

  Fly   125 AQQED---------------EVVAAEEEAKVS--DGEMPLDVQVSEEEHRRNQEQDREQPTACLP 172
            .:.::               |....||:|:|:  ..|.||      ||.|......::..|.|| 
  Fly   125 IKSDETSKLLCTAAADITMSEDALEEEDAEVNGEPEECPL------EESRPTASICKDDSTLCL- 182

  Fly   173 LRLHSIKVEHDSS--NANQQLERMVSQQS---LVSVPAAALGNHLGWSDL 217
              ....:.||.|.  :::|||...::|:.   :.|:.:|      |..||
  Fly   183 --ADQPQQEHYSQGCSSSQQLPHTMAQRKSKYITSLDSA------GEDDL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 18/90 (20%)
BESS 267..301 CDD:460758
CG15601NP_573058.1 MADF_DNA_bdg 14..101 CDD:463144 17/88 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.