DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and madf-2

DIOPT Version :10

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_492896.1 Gene:madf-2 / 173019 WormBaseID:WBGene00009461 Length:290 Species:Caenorhabditis elegans


Alignment Length:279 Identity:47/279 - (16%)
Similarity:97/279 - (34%) Gaps:95/279 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MARKDDPVFNVRFVQFVENQPCLWNYTHPGYSKKEDVQRA-WQQVAND--------IKDTVRNCR 61
            ||:..||.... .:..:.|:|.:|:..:.|.|....::.: .::|.::        ||.|..:.|
 Worm     1 MAQWTDPSRQC-LINAIRNRPVIWDKNYFGESNYRTLKTSCLREVTSELNSMFQMPIKFTCEDVR 64

  Fly    62 ERWRTIRSSFLRSLKLARTQTGRGKR----------KYYLSKYLQF------------------L 98
            .:|:.::.:|:|.|:...    .||.          |:|  :.|.|                  |
 Worm    65 SQWKNLKDTFVRKLRWVH----EGKYMEDAMKEPTWKFY--RMLTFLDEKEAKRLGDTCEHTYEL 123

  Fly    99 VPFTKSRSCHK-------------------------QLPGMVLRKPGQAATAQQEDEVVAA---- 134
            .|  .|.||.:                         ||....:....|.||...|.::.::    
 Worm   124 AP--NSTSCGQRAQISYEPTSTEEKMFQMFNNQPPPQLSQQSMIDSSQIATCSNEPKMTSSSTFV 186

  Fly   135 ------EEEAKVSDGEMP------LDVQVSEEEHRRNQEQD-REQPTACLPLRL-------HSIK 179
                  :.....|....|      |:.::.:|:.:..:::. |.|.:...|:::       |..:
 Worm   187 TSSTSLKRGVHYSPTRSPNGSSSGLEEELEDEDEQPGRKKSCRRQVSNIQPMQVITTPPVAHQDE 251

  Fly   180 VEHDSSNANQQLERMVSQQ 198
            .:|..:.....|.|:.::|
 Worm   252 FDHFGAMVAANLRRIANEQ 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 22/122 (18%)
BESS 267..301 CDD:460758
madf-2NP_492896.1 MADF 11..107 CDD:214738 20/102 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.