DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and LOC110439798

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_021332041.1 Gene:LOC110439798 / 110439798 -ID:- Length:273 Species:Danio rerio


Alignment Length:328 Identity:73/328 - (22%)
Similarity:108/328 - (32%) Gaps:124/328 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 WVAMARKDDPVFNVRFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTI 67
            |.|||.::      ..::.|...|.|.|.....|...|..:|.|:.||..|..:|..|:.||:||
Zfish    23 WSAMAAEE------TLLRAVYRIPLLHNRLRTDYRSTERRERVWRDVAASIGLSVVECKRRWKTI 81

  Fly    68 RSSFLRSLKLARTQTGRGKRKYYL---SKYLQFLVPFTKSRSCHKQLPGMVLRKPGQA------- 122
            |..::|..:|.:.:...|.|:.:.   .:.|.||....:.|           |:|..|       
Zfish    82 RDRYIRERRLCKLKKDLGGRRLHYWPHRESLAFLDAHIRKR-----------RRPSGAQGPEEEQ 135

  Fly   123 -----ATAQQEDEVVAAEEEAKVSDGE--------MPLDV--------QVSEEEHRRNQEQDREQ 166
                 :.|.|||:....:||. |||..        :||.:        |||              
Zfish   136 QEEHSSAALQEDKEECVQEEC-VSDSSRFVSPLNPLPLSIVTQLKPVPQVS-------------- 185

  Fly   167 PTACLPLRLHS----IKVEHDSSNANQQLERMVSQQSLVSVPAAALGNHLGWSDLTQWFKGHGSG 227
                 ||.|.|    :||...||:|...|            ||:|....|               
Zfish   186 -----PLLLTSLPPGLKVAPASSSAPPLL------------PASASAGPL--------------- 218

  Fly   228 HHKLTTTTTTPTSPPPPPQPATSALSVFTGGPGGGGSQPDADYSFLISLHPYIKEMNGKQNRKFR 292
                       ..|....|.|..||              |.|..||:|..|.:|.:..::....:
Zfish   219 -----------NVPLEEQQRADGAL--------------DEDQLFLLSYVPALKRLTPQKRAAVK 258

  Fly   293 QKV 295
            .::
Zfish   259 MQI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 25/88 (28%)
BESS 267..301 CDD:281011 7/29 (24%)
LOC110439798XP_021332041.1 MADF 32..120 CDD:214738 25/87 (29%)
BESS 233..267 CDD:308542 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.