DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and LOC110438041

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_021323091.1 Gene:LOC110438041 / 110438041 -ID:- Length:277 Species:Danio rerio


Alignment Length:243 Identity:51/243 - (20%)
Similarity:79/243 - (32%) Gaps:82/243 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EDVQRAWQQVANDIK-DTVRN---CRERWRTIRSSFLR-SLKLARTQTGRGKRKYYLSKYLQFLV 99
            |..|.||    |||. .|.:|   ||:.|:.:|..|:| ..|:.......|..:..::: |.:|.
Zfish    32 ELTQSAW----NDISAATGKNEAVCRKAWKNLRDKFVRIKRKIHTNSKDPGSYRKIVAE-LGWLC 91

  Fly   100 PFTKSRSCHKQLPGMVLRKPGQAATAQQEDEVVAAEEEAKVSDGEMPLDVQVSEEEHRRNQEQDR 164
            .:.|.|.              ::..|:...:.|..||..|..:.:|......||     ....|.
Zfish    92 QYVKHRE--------------KSLNAKDGCKGVTFEEFMKTDNLQMSSASGTSE-----TGTSDN 137

  Fly   165 EQPTACLPLRLHSIKVEHDSSNANQQLERMVSQQSLVSVPAAALGNHLGWSDLTQWFKGHGSGHH 229
            ..|.:.:|            |:.......:.:|.:|  |||                        
Zfish   138 PSPLSLMP------------SSPVPSTPVLPTQSTL--VPA------------------------ 164

  Fly   230 KLTTTTTTPTSPPPP-------PQPA-TSALSVFTGGPGGGGSQPDAD 269
                   |.::||||       |.|. .||.||....|....|...::
Zfish   165 -------TSSTPPPPCPSSKCYPSPCLVSAFSVPNISPSPNASPSSSE 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 19/67 (28%)
BESS 267..301 CDD:281011 0/3 (0%)
LOC110438041XP_021323091.1 MADF_DNA_bdg 10..77 CDD:313715 16/48 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.