DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and LOC100330838

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001373242.1 Gene:LOC100330838 / 100330838 -ID:- Length:204 Species:Danio rerio


Alignment Length:142 Identity:38/142 - (26%)
Similarity:63/142 - (44%) Gaps:16/142 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLRSLKL--AR 79
            |.:..|.:.|.|:|.|...|.......:||:.|:..::....:||.||:::|..|::..:.  .|
Zfish     8 RLIAAVSDYPELYNSTINSYKDAARKAKAWRAVSLQVEIPEEDCRRRWKSLRDMFIKDKRAEQRR 72

  Fly    80 TQTGRGKRKYYLSKYLQFLVPFTKSRSCHKQLPGMVLRKPGQAATAQQEDEVVAAEEEAKVSDGE 144
            ..:|...|.:..|..:.||.||.:|||.              ||...:||.....::|.:.:||.
Zfish    73 RASGTSHRSWKYSWQMSFLTPFIQSRSL--------------AADEPEEDRDDEDKDEERTADGN 123

  Fly   145 MPLDVQVSEEEH 156
            ....||..|.:|
Zfish   124 SAFVVQDFEGDH 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 24/87 (28%)
BESS 267..301 CDD:281011
LOC100330838NP_001373242.1 MADF 8..96 CDD:214738 24/87 (28%)
BESS 167..200 CDD:397204
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.