DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXC8 and unpg

Sequence 1:NP_073149.1 Gene:HOXC8 HGNCID:5129 Length:242 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:174 Identity:47/175 (27%)
Similarity:68/175 (39%) Gaps:51/175 (29%)


Human    62 HGTSGISNSGYQQNPC-------SLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSAN 119
            |.:...|.|.....|.       ...|.||:.........||.  |..:.:.|       ::.|.
  Fly   225 HSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRN--YNGEMDKS-------RNGAY 280

Human   120 TNS----------------------SEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTL 162
            |||                      .:.||:.:.::|.|             |..|..::..|.|
  Fly   281 TNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKS-------------RRRRTAFTSEQLL 332

Human   163 ELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKK 206
            |||:||....||:...|.:::.:|.|:|.||||||||||.|||:
  Fly   333 ELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXC8NP_073149.1 Antp-type hexapeptide 138..143 0/5 (0%)
Homeobox 153..205 CDD:306543 26/52 (50%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.