DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and ULP1

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_015305.1 Gene:ULP1 SGDID:S000005941 Length:621 Species:Saccharomyces cerevisiae

Alignment Length:589 Identity:122/590 (21%)
Similarity:200/590 (34%) Gaps:205/590 (35%)


  Fly   116 EEFYRKVHQSKASSADAAPPNAMAGEEHSPAVVKPSETAVAN-----NGCQPAASATKGK----- 170
            |.:.....:.|..::..|.||.....| |..|..||.:.:::     :.|....|.|..:     
Yeast   147 ENYSSDTRKHKFDTSTWALPNKRRRIE-SEGVGTPSTSPISSLASQKSNCDSDNSITFSRDPFGW 210

  Fly   171 -KHKKSPCGSPGENNDGQVILSADQDANTNTKAKKQ------KKCHIAKDNNGIQAASSHDNPSS 228
             |.|.|..||..|||      ::||   .|:..::|      :|..:||.|              
Yeast   211 NKWKTSAIGSNSENN------TSDQ---KNSYDRRQYGTAFIRKKKVAKQN-------------- 252

  Fly   229 SGNKQGSHNSTAITSNSTMTS-NGLRGVQPAE-DAPAISQWIQSRNNAAVSKKSEETAGGSQSRV 291
                   .|:|.:.|.:.... ..||.:...| ..|.|.:..:.|....:....|:..|..:|.:
Yeast   253 -------INNTKLVSRAQSEEVTYLRQIFNGEYKVPKILKEERERQLKLMDMDKEKDTGLKKSII 310

  Fly   292 QSNVASISSPAVKATSDAAIPTPAERAERSRLRRNRNWILSRDVDEDAVVLV-----SSGDE--- 348
            ..                     .|:.:...:..|:|.:.:|:.::|.:|.|     ||.:.   
Yeast   311 DL---------------------TEKIKTILIENNKNRLQTRNENDDDLVFVKEKKISSLERKHK 354

  Fly   349 ---------------------------------------------------ETTAADDGQTERRL 362
                                                               |....||.|.::.|
Yeast   355 DYLNQKLKFDRSILEFEKDFKRYNEILNERKKIQEDLKKKKEQLAKKKLVPELNEKDDDQVQKAL 419

  Fly   363 SPDENQTLFTYPPTGTGGLSITIKDFMCLSKGSYLNDIIIDFYLRWLKNNIIPEEQRDRTHIFST 427
            :..||..|.     ....:.||::||..|:...:|||.||:|:::::      |:....|..|::
Yeast   420 ASRENTQLM-----NRDNIEITVRDFKTLAPRRWLNDTIIEFFMKYI------EKSTPNTVAFNS 473

  Fly   428 FFHKRLTTRTNPRNTKQTAAQKRHERVEKW-TRNVNIFDK-DFIIIPFN-EQSHWILAIICYPNL 489
            ||:..|             :::.::.|.:| .|.....|| |.|..|.| .||||.|.|      
Yeast   474 FFYTNL-------------SERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGI------ 519

  Fly   490 RSPVVNNNNVQTTLSDDIPIKQPLILIFDSLAVTSRHRAIAILRD---YLTCEHKAKYPNALAHV 551
                             |.:|:..|...|||:......:.|||.|   |:..|.|        |.
Yeast   520 -----------------IDLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESK--------HT 559

  Fly   552 FNKDNMPGHSVEVPQQQNLTDCGLYL-LQYVEQFFTKPINDYTLPIKELSNWFDLLTVTKKREDI 615
            ..:|....| ::.|||.|..|||:|: :..:......|::            ||.....:.|..|
Yeast   560 IGEDFDLIH-LDCPQQPNGYDCGIYVCMNTLYGSADAPLD------------FDYKDAIRMRRFI 611

  Fly   616 ANLI 619
            |:||
Yeast   612 AHLI 615

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 41/216 (19%)
Peptidase_C48 396..585 CDD:304959 51/196 (26%)
ULP1NP_015305.1 ULP1 36..621 CDD:227489 122/590 (21%)
Peptidase_C48 447..617 CDD:280975 59/233 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.