DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and ULP2

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_012233.1 Gene:ULP2 SGDID:S000001293 Length:1034 Species:Saccharomyces cerevisiae

Alignment Length:571 Identity:121/572 (21%)
Similarity:236/572 (41%) Gaps:151/572 (26%)


  Fly   171 KHKKSPCGSPGENNDGQVILSADQDANTNTKAKKQK---------KCH---IAKDNNGIQAASSH 223
            ||...|..|...:.:.:..:::.::|..:.:.||.|         :.|   ::...:|:|:.:..
Yeast   288 KHLIHPISSSSPSLNMERAINSTKNAFDSLRLKKTKLSTNDDESPQIHTHFLSNKPHGLQSLTKR 352

  Fly   224 DNPSSSGNKQGSHNSTAITSNSTMTSNGLRGVQPAEDAPAISQWIQSRNNAAVSKKSEETAGGSQ 288
            ...:|.|.|:  |:.:...||                               :|........|::
Yeast   353 TRIASLGKKE--HSISVPKSN-------------------------------ISPSDFYNTNGTE 384

  Fly   289 SRVQSNVASISSPAVKATSDAAIPTPAERAERSRLRRNRNWILSRDVDEDAVVLVSSGDEETTAA 353
                    ::.|.||                 |:|||:..:   :||.:.|      .....:..
Yeast   385 --------TLQSHAV-----------------SQLRRSNRF---KDVSDPA------NSNSNSEF 415

  Fly   354 DDGQTERRLSPDENQTLFTYPPTGTGGLSITIKDFMCLSKGSYLNDIIIDFYLRW-----LKNNI 413
            ||..||.. :|:..:....|........:||.:||.||....::||.|:||:.::     ::.:|
Yeast   416 DDATTEFE-TPELFKPSLCYKFNDGSSYTITNQDFKCLFNKDWVNDSILDFFTKFYIESSIEKSI 479

  Fly   414 IPEEQRDRTHIFSTFFHKRLTTRTNPRNTKQTAAQKRHERVEKWTRNVNIFDKDFIIIPFNEQSH 478
            |   :|::.|:.|:||:.:|.  :||.:        .:..|:||..|.::|.|.:::||.|...|
Yeast   480 I---KREQVHLMSSFFYTKLI--SNPAD--------YYSNVKKWVNNTDLFSKKYVVIPINISYH 531

  Fly   479 WILAIICYPNLRSPV---VNNNNVQTTLSDDIPIKQPL--ILIFDSLAVTSRHRAIAILRDYLTC 538
            |...||  .||.:.:   .|.:......||:|.|..||  ||.||||..| ..|.|..::::|..
Yeast   532 WFSCII--TNLDAILDFHQNKDKNDAINSDEISINNPLVNILTFDSLRQT-HSREIDPIKEFLIS 593

  Fly   539 EHKAKYPNALAHVFNKDNMPGHSVEVPQQQNLTDCGLYLLQYVEQFFTKPINDYTLPI------- 596
            ....||...|    :|..:...:..||||.|::|||::::..:.:||..|:.  |:.:       
Yeast   594 YALDKYSIQL----DKTQIKMKTCPVPQQPNMSDCGVHVILNIRKFFENPVE--TIDVWKNSKIK 652

  Fly   597 ------KELSNWFDLLTVTKKREDIANLIKKL-------MNESNQQRKILPV--IKFPTLNGQLV 646
                  |.::.:||.......|:::.:.:|.|       :.:.|...:::.:  .|...:|....
Yeast   653 SKHFTAKMINKYFDKNERNSARKNLRHTLKLLQLNYISYLKKENLYEEVMQMEEKKSTNINNNEN 717

  Fly   647 MDEEDSE-------EENSKEEH----------KTTLVCSKDRKPPRRRNTL 680
            .|::|.|       :::||:.:          :::.:.:.:|:|....|::
Yeast   718 YDDDDEEIQIIENIDQSSKDNNAQLTSEPPCSRSSSISTTEREPTELHNSV 768

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 22/160 (14%)
Peptidase_C48 396..585 CDD:304959 60/199 (30%)
ULP2NP_012233.1 ULP1 45..695 CDD:227489 110/497 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131145734
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6692
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000927
OrthoInspector 1 1.000 T634866
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.778 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1602
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.