DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and ULP1D

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_176228.3 Gene:ULP1D AraportID:AT1G60220 Length:584 Species:Arabidopsis thaliana

Alignment Length:591 Identity:137/592 (23%)
Similarity:224/592 (38%) Gaps:111/592 (19%)


  Fly    75 DLQIDESTTIDCIENAGGIIHLVVSVGFP-----ISDNIAETVAHAEEFYRKVHQSKASSADAAP 134
            |..:||.     :|....|  |.:..|.|     |...||:.   .||..|:|.:......|.: 
plant    66 DRDLDEQ-----LERKKAI--LTLGPGLPDKGEKIRLKIADL---EEEKQRRVLEGSKMEVDRS- 119

  Fly   135 PNAMAGEEHSPAVVKPSETAVANNGCQPAASATKGKKHKKSPCGSPGENNDGQVILSADQDANTN 199
             :.:.....|.:.|.|...||:.:       .::|....|. ....|..:..:|..|......:.
plant   120 -SKVVSSTSSGSDVLPQGNAVSKD-------TSRGNADSKD-TSRQGNADSKEVSRSTFSAVFSK 175

  Fly   200 TKAKKQKKCHIAKDNNGIQAASSHDNPSSSGNKQGSHNSTAITSNSTMTSNGLR---GVQPAEDA 261
            .|...|.|....|:   ::..........:|.|.           .|..|||.|   .|..||. 
plant   176 PKTDSQSKKAFGKE---LEDLGCERRKHKAGRKP-----------VTRLSNGWRLLPDVGKAEH- 225

  Fly   262 PAISQWIQSRNNAAVSKKSEETAGGSQSRVQSNVASISSPAVKATSD----AAIPTPAERA-ERS 321
             :..|:......:..:|||:|..|..:....|..:.|.........|    :...||.|.: |:|
plant   226 -SAKQFDSGLKESKGNKKSKEPYGKKRPMESSTYSLIDDDDDDDDDDDNDTSGHETPREWSWEKS 289

  Fly   322 RLRRNRNWILSRDVDEDAVVLVSSGDEETTAADDGQTERRLSPDENQTLFTYPPTGTGG-LSITI 385
            ..:.:|.    |...||.|:.|   |||.........:....|:..|....||...... :.:.:
plant   290 PSQSSRR----RKKSEDTVINV---DEEEAQPSTVAEQAAELPEGLQEDICYPTRDDPHFVQVCL 347

  Fly   386 KDFMCLSKGSYLNDIIIDFYLRWLKNNIIPEEQRDR-THIFSTFFHKRLTTRTNPRNTKQTAAQK 449
            ||..||:...||...:::||:|:|:..|....|... .|.|:|:|:|:|:.....:...:.|...
plant   348 KDLECLAPREYLTSPVMNFYMRFLQQQISSSNQISADCHFFNTYFYKKLSDAVTYKGNDKDAFFV 412

  Fly   450 RHERVEKWTRNVNIFDKDFIIIPFNEQSHWILAIICYPNLRSPVVNNNNVQTTLSDDIPIKQPLI 514
            |..|   |.:.:::|.|.:|.||.:|..||.|.|:|.|:.:.        ::.|:         |
plant   413 RFRR---WWKGIDLFRKAYIFIPIHEDLHWSLVIVCIPDKKD--------ESGLT---------I 457

  Fly   515 LIFDSLAVTSRHRAIAILRDYLTCEHKAKYPNALAHVFNKD--------------NMPGH----S 561
            |..|||.:.||...:..::.:|..|.         :..|:|              |:|..    .
plant   458 LHLDSLGLHSRKSIVENVKRFLKDEW---------NYLNQDDYSLDLPISEKVWKNLPRRISEAV 513

  Fly   562 VEVPQQQNLTDCGLYLLQYVEQFFTKPINDYTLPIKEL----SNWFDLLTVTKKREDIANLIKKL 622
            |:||||:|..|||.::|.::::|..:.  ...|..|:|    ..||.....:..|..|.|.:.:|
plant   514 VQVPQQKNDFDCGPFVLFFIKRFIEEA--PQRLKRKDLGMFDKKWFRPDEASALRIKIRNTLIEL 576

  Fly   623 MNESNQ 628
            ...|:|
plant   577 FRVSDQ 582

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 38/205 (19%)
Peptidase_C48 396..585 CDD:304959 55/208 (26%)
ULP1DNP_176228.3 Peptidase_C48 357..567 CDD:280975 61/241 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.