DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and OTS2

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_172527.2 Gene:OTS2 AraportID:AT1G10570 Length:571 Species:Arabidopsis thaliana

Alignment Length:613 Identity:131/614 (21%)
Similarity:217/614 (35%) Gaps:193/614 (31%)


  Fly   140 GEEHSPAV-------VKPSETAVANNGCQPAAS---------------------------ATKGK 170
            |:|..|.:       :.|.|..:  :|.:||.|                           |.||:
plant    26 GDEEVPELEIIATDKIPPREPTL--SGYEPAVSVRSLRDNELDDHLKRQRSLLTRLGDKLADKGE 88

  Fly   171 KHKKSPCGSPGENNDGQVILSAD----------QDANTNTKAKKQKKCHI---AKDNNGIQAASS 222
            |.:         |..|::.....          |||:..        |.|   .|.::....||:
plant    89 KIR---------NRIGELEYEKQRRMFQQRTKMQDADNG--------CQILEKPKSSDVFMRAST 136

  Fly   223 HDNPSSSGNKQGSHNSTAITSNSTMTSNGLRGVQPA-------EDAPAISQWIQSRNNAAVSKKS 280
            ....:|.....||.:.:..|..:..:.|...|.||.       :|. ....||...|..::.:|:
plant   137 ASKDTSGQGTSGSKDVSRSTFAAHFSDNLKMGPQPVKLVNDKLQDL-GRGSWISKANRDSIIEKN 200

  Fly   281 EETAGGSQSRVQSNVASI---------------------------SSPAVKATSD-------AAI 311
              ....|..|:.....|:                           |||.:....|       ...
plant   201 --NVWRSLPRLSKCKVSLKNFYSESKDPKGDRRPNEAYGKGKPNESSPYLLVDDDDGDDDKVIGY 263

  Fly   312 PTP------AERAERSRLR-RNRNWILSRDVDEDAVVLVSSGDEETTAADDGQTERRLSPDENQT 369
            .||      |...:.|..| ::.:.:::.|.||....:|.   ||.....:|..|....|..:|:
plant   264 ETPRHWSLKASPLQSSSCRKKSDDKVINLDEDEPLSPMVV---EEACELPEGLPEDIYYPSSDQS 325

  Fly   370 LFTYPPTGTGGLSITIKDFMCLSKGSYLNDIIIDFYLRWLKNNIIPEEQRDRT----HIFSTFFH 430
                  .|...:.:::||..|||.|.||...:|:||:|::::::.   ..|:|    |.|:|||:
plant   326 ------DGRDLVQVSLKDLKCLSPGEYLTSPVINFYIRYVQHHVF---SADKTAANCHFFNTFFY 381

  Fly   431 KRLTTRTNPRNTKQTAAQKRHERVEKWTRNVNIFDKDFIIIPFNEQSHWILAIICYPNL------ 489
            |:||...:.:...:.|...:..|   |.:..::|.|.:|.||.:|..||.|.|||.|:.      
plant   382 KKLTEAVSYKGNDRDAYFVKFRR---WWKGFDLFCKSYIFIPIHEDLHWSLVIICIPDKEDESGL 443

  Fly   490 ------------RSPVVNN-----NNVQTTLSDDIPIKQPLILIFDSLAVTSRHRAIAILRDYLT 537
                        |:.:.||     ......|:.|.|:..|:              :..:.||   
plant   444 TIIHLDSLGLHPRNLIFNNVKRFLREEWNYLNQDAPLDLPI--------------SAKVWRD--- 491

  Fly   538 CEHKAKYPNALAHVFNKDNMPGHSVEVPQQQNLTDCGLYLLQYVEQFFTKPINDYTLPIKEL--S 600
                  .||.:...         .|:||||:|..||||:||.::.:|..:.....||...::  .
plant   492 ------LPNMINEA---------EVQVPQQKNDFDCGLFLLFFIRRFIEEAPQRLTLQDLKMIHK 541

  Fly   601 NWFDLLTVTKKREDIANLIKKLMNESNQ 628
            .||.....:..|..|.|::..|..:.||
plant   542 KWFKPEEASALRIKIWNILVDLFRKGNQ 569

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 46/273 (17%)
Peptidase_C48 396..585 CDD:304959 56/216 (26%)
OTS2NP_172527.2 Peptidase_C48 345..545 CDD:280975 60/238 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.