DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and AT4G33620

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001320126.1 Gene:AT4G33620 AraportID:AT4G33620 Length:774 Species:Arabidopsis thaliana

Alignment Length:689 Identity:170/690 (25%)
Similarity:268/690 (39%) Gaps:160/690 (23%)


  Fly    34 DTDPDKGSARMLIIYSS---GKQHIVTFKLPNLACRVQDLFFQMDLQIDESTTIDCIENAGGIIH 95
            |...::.|.::|..:.|   .|.|....|...|.|      |..|.| .||..:.         |
plant    24 DDRVEEESKKLLRKFDSPVTKKHHCAIDKYEFLRC------FAKDTQ-SESKVLQ---------H 72

  Fly    96 LVVSVGFPISD-------------NIAETVAHAEEFYRKVH-QSKASSADAAPPNAMAGEEHSPA 146
            :|:.|..|:.:             ::.:.:::..  :|::. .|..||:.:.......||..:||
plant    73 IVIDVEVPVKEEPSRCELSGDGNSDLIDVISNGS--HRRIGIDSLTSSSLSENDEVSTGEATNPA 135

  Fly   147 VVKPSETAVANNGCQPAASATKGKKHKKSPCGSPGENNDGQVILSAD-----QDANTNTKAKKQK 206
                                  ...|:..|     ||  .||::..|     ....||:|....:
plant   136 ----------------------SDPHEVDP-----EN--AQVLIIPDVIIYGDIYCTNSKLTFSR 171

  Fly   207 KCHIAKDNNGIQAASSHDNPSSSGNKQGSHNSTAITSNSTMTSNGLRGVQPAEDAPAISQWIQSR 271
            .|.               |..||     |.|:|..|.:...|...:..::        |||....
plant   172 NCM---------------NVESS-----SVNATKGTFSCQWTIEDIIKIE--------SQWCLEV 208

  Fly   272 NNAAVS--KKSEETAGGSQSRVQSNVASISSPAVKATSDAAIPTPAERAE--RSRLRRNRN-WIL 331
            ..|.|:  .||.:..|...::..|.:..:......       |..::..|  ||...|.:| |. 
plant   209 ETAFVNVLLKSRKPEGVDIAKDISGIDLLKFSVYD-------PKWSKEVETIRSLDSRYKNIWF- 265

  Fly   332 SRDVDEDAVVLVSSGDEETTAADDGQTERRLSPDENQTLFTYPPTGTGGLSITIKDFMCLSKGSY 396
              |...::..:..||.      |.|.:...|: |..:.| .||......:.:..:|...|....:
plant   266 --DTITESEEIAFSGH------DLGTSLTNLA-DSFEDL-VYPQGEPDAVVVRKQDIELLKPRRF 320

  Fly   397 LNDIIIDFYLRWLKNNIIPEEQRDRTHIFSTFFHKRLTTRTNPRNTKQT-AAQKRHERVEKWTRN 460
            :||.|||||:::|||.|.|:| |.|.|.|:.||.::|...  .:.|..| ..::.::||:|||:|
plant   321 INDTIIDFYIKYLKNRISPKE-RGRFHFFNCFFFRKLANL--DKGTPSTCGGREAYQRVQKWTKN 382

  Fly   461 VNIFDKDFIIIPFNEQSHWILAIICYPNLRSPVVNNNNVQTTLSDDIPIKQPLILIFDSLAVTSR 525
            |::|:||:|.||.|...||.|.|||:|....|    ::|:.      |.:.|.||..||:..:.:
plant   383 VDLFEKDYIFIPINCSFHWSLVIICHPGELVP----SHVEN------PQRVPCILHLDSIKGSHK 437

  Fly   526 HRAIAILRDYLTCEHKAKYPNALAHVFNKDNMPGHSVEVPQQQNLTDCGLYLLQYVEQFFTKPIN 590
            ...|.|...||..|.||::.|.........||...|:|:|||:|..||||:||.|::.|..:...
plant   438 GGLINIFPSYLREEWKARHENTTNDSSRAPNMQSISLELPQQENSFDCGLFLLHYLDLFVAQAPA 502

  Fly   591 DYTLPIKELS------NWFDLLTVTKKREDIANLIKKLMNESNQQRKILPV--IKFPTLNGQLVM 647
            .:...:...|      |||.....:.||.:|..|:..|  .......|||.  ...|...|....
plant   503 KFNPSLISRSANFLTRNWFPAKEASLKRRNILELLYNL--HKGHDPSILPANSKSEPPHCGVSNR 565

  Fly   648 DEEDSEEENSKE----------------EHKTTLVCSKD 670
            :::::|.||..|                :...|..||.|
plant   566 NDQETESENVIECCNWIKPFDGSSSTVTDISQTKTCSPD 604

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 36/205 (18%)
Peptidase_C48 396..585 CDD:304959 75/190 (39%)
AT4G33620NP_001320126.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T32369
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.