DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and Senp2

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_008767027.1 Gene:Senp2 RGDID:708378 Length:593 Species:Rattus norvegicus

Alignment Length:619 Identity:127/620 (20%)
Similarity:215/620 (35%) Gaps:200/620 (32%)


  Fly   105 SDNIAETVAHAEEFYRK-------VHQSKASSADAAP--------------PNAMAGEEHSPAVV 148
            |.::..|....:|...|       :||.|.|..:||.              .:|..|..:    |
  Rat    33 SSSLFSTAVDTDEIPAKRPRLDCFIHQVKNSLYNAASLFGFPFQLTTKPMVSSACNGTRN----V 93

  Fly   149 KPSETAVANN-GCQPAASATKG---KKHKKSPCG----------------------------SPG 181
            .||....:|: .|:...|.:..   |...|||.|                            |.|
  Rat    94 APSGEVFSNSPSCELTTSGSCSSMLKLGNKSPNGISDYPKIRVTVARDQPRRVLPSFGFTLKSEG 158

  Fly   182 ENN--DGQVILSADQDANTNTKAKKQKKCHIAKDNNGIQAASSHDNPSSSGN------------- 231
            .|.  .|:....::.:::...|.::|....:..:..|..|...|........             
  Rat   159 YNRRPSGRRHSKSNPESSLPWKPQEQGVTEMISEEGGKGARRPHCTVEEGVQKDEREKYLKLLER 223

  Fly   232 -KQGSHNST---AITSNSTMTSNGLRGVQPAEDAPAISQWIQSRNNAA-----VSKKSE--ETAG 285
             |:|:|.||   |::.:|:..:.        .|......|::.:|:..     |.|:..  ||.|
  Rat   224 LKEGAHGSTFPPAVSHHSSQRTQ--------MDTLKTKGWMEEQNHGVRTTHLVPKQYRVVETRG 280

  Fly   286 -----GSQSRVQSNVASISSPAVKATSDAAIPTPAER----------------AERSRLRRNRNW 329
                 .|:.|....         ||.::..:....|:                :.|.||....|.
  Rat   281 PLCSVRSEKRYSKG---------KADTEKVVGLRFEKDGTRGHQLEPDLSEEVSARLRLGSGSNG 336

  Fly   330 ILSRDVDEDAVVLVSS-----GDEETTAADD--GQTERRLSPDENQTLFTY----PP----TGTG 379
            :|.|.:.    ||.:.     ..|:....:|  ..||.||..|..:.:...    ||    :...
  Rat   337 LLRRKIS----VLEAKEKNFPSKEKDRRTEDLFELTEHRLIQDMEKEISNALGHGPPDEILSSAF 397

  Fly   380 GLSITIKDFMCLSKGSYLNDIIIDFYLRWLKNNIIPEEQRDR----THIFSTFFHKRLTTRTNPR 440
            .|.||..|...|....:|||.:|:||:     |::.|..:.:    .|..||||:.:|.:     
  Rat   398 KLRITRGDIQTLKNYHWLNDEVINFYM-----NLLVERSKKQGYPALHALSTFFYPKLKS----- 452

  Fly   441 NTKQTAAQKRHERVEKWTRNVNIFDKDFIIIPFNEQSHWILAIICYPNLRSPVVNNNNVQTTLSD 505
                    ..::.|::||:.||:||::.:::|.:.:.||.|.:                      
  Rat   453 --------GGYQAVKRWTKGVNLFDQELVLVPIHRKVHWSLVV---------------------- 487

  Fly   506 DIPIKQPLILIFDSLAVTSRHRAIAILRDYLTCEHKAKYPNAL-----AHVFNKDNMPGHSVEVP 565
             :.:::..:...||:. ...||...||..||..|.|.|....|     .|.    :|..|  |:|
  Rat   488 -MDLRKKCLKYLDSMG-QKGHRICEILLQYLQDESKTKRNTDLNLLEWTHY----SMKPH--EIP 544

  Fly   566 QQQNLTDCGLYLLQYVEQFF-TKPI--NDYTLPI 596
            ||.|.:|||::..:|.:... .|||  ..:.:|:
  Rat   545 QQLNGSDCGMFTCKYADYISRDKPITFTQHQMPL 578

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 48/290 (17%)
Peptidase_C48 396..585 CDD:304959 49/198 (25%)
Senp2XP_008767027.1 Peptidase_C48 <372..588 CDD:304959 62/256 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.