DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and Senp7

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_079759.2 Gene:Senp7 MGIID:1913565 Length:1037 Species:Mus musculus

Alignment Length:732 Identity:196/733 (27%)
Similarity:290/733 (40%) Gaps:248/733 (34%)


  Fly   120 RKVHQS-KASSADAAPPNAMAGEE-HSPAV--------VKPSETAVANNGCQPAAS--------- 165
            ||:.:| :.|..|.|||..:|.|. .|.|.        .:|..:|.:.....|..|         
Mouse   330 RKLEESGEDSHQDPAPPEGLAPESLESEATNLRSFAAGQEPDASAASGRASSPNKSLESSASSEV 394

  Fly   166 ------ATKGK----KHKKSPCGSPGEN----NDGQVILSADQDANTNTK----AKKQKKCHIAK 212
                  |.||:    |....|.||..|:    :...:::|:|::.....|    .|.|....|..
Mouse   395 SENSSVAVKGEALTLKEASPPGGSSEESQLLISAEPIVVSSDEEGPVEHKNSVILKLQPPHEIMS 459

  Fly   213 DNNG----------------IQAASS--HDNP---------SSS-------------------GN 231
            :|.|                :|..|.  ..||         |:|                   |.
Mouse   460 ENQGTSDPQLSELTLGACESVQVTSELFPYNPDVENISCIKSNSEMDLKLDFIFTCVYIGKIKGT 524

  Fly   232 KQG---------------SHNSTAITSNST--------------------------MTSNGLRGV 255
            .:|               |.|..::|.::.                          ::|:.|:.:
Mouse   525 PKGCVTFTKKYIKIPFQVSTNEISLTVDTARLKRFGLWESKDEDHSKRSHAILFLWLSSDYLQDI 589

  Fly   256 QPAEDAPAISQWIQSRN------NAAVSKKSE----------ETAGGSQSRVQSNVASISSPAVK 304
            |...:.|.:||..::..      |:::|::.|          .|..|:..      .|...|.|:
Mouse   590 QTQLENPMLSQQSKANEFIFLELNSSISQREELKLKDIMMEISTKNGNLH------LSCPLPWVQ 648

  Fly   305 A-------------------TSDAAIPTP--AERAERSRLRRNRNWILSRDVDEDAV-------- 340
            |                   .|.:|:||.  |:..::|         :|:..:.|.:        
Mouse   649 ALPLFQDLSPQEISFLHYYYASASALPTAAGADMKKKS---------VSQPSNSDTIKPTYTFLH 704

  Fly   341 --------VLVSSGDEETTAADDGQTERRLSPDENQTLFTYPPTGT-GGLSITIKDFMCLSKGSY 396
                    :.::|..||     :.|..|...|  .|.|..|||..| |||.:|.:|..||.:|.:
Mouse   705 KQSSGCYSLSITSSPEE-----EWQEVRNTGP--VQKLIVYPPPPTKGGLGVTNEDLECLEEGEF 762

  Fly   397 LNDIIIDFYLRWLKNNIIPEEQRDRTHIFSTFFHKRLTTRTN---PRNTKQTAAQKRHERVEKWT 458
            |||:||||||::|......:|..:|:||||:||:|.||.:.|   ..|...:.||:||.||..||
Mouse   763 LNDVIIDFYLKYLLLEKASDELVERSHIFSSFFYKCLTRKENNLTEDNPDLSVAQRRHRRVRTWT 827

  Fly   459 RNVNIFDKDFIIIPFNEQSHWILAIICYPNLRSPV----------------------VNNNNVQT 501
            |::|||:||:|.:|.||.|||.||:||:|.|...|                      :.:|:..|
Mouse   828 RHINIFNKDYIFVPVNESSHWYLAVICFPWLEEAVYEDCPQTVSQQFQGQQSQHDHKMTDNDPHT 892

  Fly   502 T--------------LSDDIP---IKQPLILIFDSLAVTSRHRAIAILRDYLTCEHKAKYPNALA 549
            |              ::..:|   .|:|.|||.|||...|....:..||:||..|.:.|  ....
Mouse   893 TSTVSTSAEDSQSTEVNMSVPKKMCKRPCILILDSLKAASIQNTVQNLREYLEVEWEVK--RKTH 955

  Fly   550 HVFNKDNMPGHSVEVPQQQNLTDCGLYLLQYVEQFFTKPINDYTLPIKELSNWFDLLTVTKKRED 614
            ..|:|.||.....:||:|.|.:|||:|||||||.||..||.::.||| .|..||....:..||||
Mouse   956 REFSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFQDPIVNFELPI-HLEKWFPRHVIKTKRED 1019

  Fly   615 IANLIKKLMNESNQQRK 631
            |..||.||   ..||:|
Mouse  1020 IRELILKL---HLQQQK 1033

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 61/358 (17%)
Peptidase_C48 396..585 CDD:304959 89/231 (39%)
Senp7NP_079759.2 Protease. {ECO:0000250} 747..1037 116/294 (39%)
Peptidase_C48 761..998 CDD:304959 92/239 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107335631
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6692
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000927
OrthoInspector 1 1.000 T617022
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46896
Phylome 1 0.910 0.917 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1602
TreeFam 1 0.960
98.780

Return to query results.
Submit another query.