DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and si:dkey-100n23.3

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_005167827.1 Gene:si:dkey-100n23.3 ZFINID:ZDB-GENE-070912-345 Length:991 Species:Danio rerio

Alignment Length:768 Identity:188/769 (24%)
Similarity:290/769 (38%) Gaps:230/769 (30%)


  Fly     2 DRKETVS--KDQAVRRIAHNDFILVSRQLLINRADTDPDKGSARMLIIYSSGKQHIVTFKLPNLA 64
            :|:|:..  ||.|    .|.:..|.|...|:.  :.:..:||...|   |:|    ..|::|...
Zfish   283 ERRESQESPKDAA----KHEENHLCSNGELVQ--EVEGMRGSVLRL---SAG----TDFQIPVKR 334

  Fly    65 CRV----QDLFFQMDLQID----ESTTIDCIENAGGIIHLVVSVGFPISDNIAETVAHAEEFYRK 121
            ||:    :|.....||..|    .|.|::             |..|...:.|..:....:|...:
Zfish   335 CRLDSLSEDQLLNSDLAFDTAEIRSFTLE-------------SSNFSQDETIVLSSEEEDEGEGR 386

  Fly   122 VHQSKASSADAAPPNAMAGEEHSPAVVKPSETAVANNGCQPAASATKGKKHKKSPCGSP------ 180
             .::|.|:.:..||     |......|....|.|......|.::.:..:..::...|.|      
Zfish   387 -EETKISALNIQPP-----EGTKDTNVVDESTTVYEQTKSPESNLSITEMSEEESQGIPLPLSSL 445

  Fly   181 -----GENNDGQVIL------------SADQDANTNTKAKKQKK-----------CHIAKDN--- 214
                 ...:.|.:::            |:|.....:..|....|           |.:.|||   
Zfish   446 HMGGVSAKSSGIMMITPYKITFSLKGNSSDSTVKISLSAINVYKYSLWEEHTLWGCDLDKDNEAT 510

  Fly   215 ---------NGIQAASSHDN---------PSSSG---------------------------NKQG 234
                     :..||...||:         |:.|.                           :.||
Zfish   511 PTSLLFLWLSDAQAHKLHDDLSVLELGTRPAESSTCLLLCMAEPLSGIESALLCSLLDIVVSNQG 575

  Fly   235 SHN--STAITSNSTMTSNGLRGVQPAEDAPAISQWIQSRNNAAVSKKSEETAGGSQSRVQSNVAS 297
            |..  .|.:|.     |:.|..:|.:|:...:        .....|..|:|:..:||:       
Zfish   576 SPELYCTCLTQ-----SDSLNLLQSSEETHLL--------QLLTPKPDEQTSTSAQSQ------- 620

  Fly   298 ISSPAVKATSDAAIPTPAERAERSRLRRNRNWILSRDVDEDAVVLVSSGDEETTAADDGQTERRL 362
                    .||..: .|.......|.:.:.|..|:          .:.|.|.|.....|.|.|.:
Zfish   621 --------DSDVQL-EPTYTLCHRRAQGSYNVFLA----------ATPGAEWTPYKHCGPTRRLI 666

  Fly   363 S-PDENQTLFTYPPTGTGGLSITIKDFMCLSKGSYLNDIIIDFYLRWLKNNIIPEEQRDRTHIFS 426
            . |         ||...|.|::|.:|..||..|.:|||:||||||::|.....|:....|:||||
Zfish   667 QFP---------PPPSKGALTVTTEDLECLDSGEFLNDVIIDFYLKYLLVQKAPQASVARSHIFS 722

  Fly   427 TFFHKRLTTRTNPR--NTKQTAAQKRHERVEKWTRNVNIFDKDFIIIPFNEQSHWILAIICYPNL 489
            :||:|:||.|.|..  :|...|..:||:||..|||:|:||:|||:.:|.|:::||.|.:||:|.|
Zfish   723 SFFYKQLTRRDNANEDSTSTPAQVRRHQRVRTWTRHVDIFEKDFLFVPVNQEAHWYLVVICFPGL 787

  Fly   490 RSP------------------VVNNNN--------------------------------VQTTLS 504
            ..|                  |..:.|                                .:.|..
Zfish   788 EDPQYVKRDDSASVQGNGGEDVGESENETQGDHRSNSDEDKSTDDSRIKSSTSLRQPDCTENTCK 852

  Fly   505 DDIPIKQPLILIFDSLAVTSRHRAIAILRDYLTCEHKAKYPNALAHVFNKDNMPGHSVEVPQQQN 569
            .|:.:|:|.|||.|||.::...|...:||:||..|.:.|...  ...|:.:.|.|...:||.|.|
Zfish   853 KDVVLKRPCILIMDSLKLSIHERIFKLLREYLQVEWETKRMG--TRDFSAERMVGSHCKVPLQDN 915

  Fly   570 LTDCGLYLLQYVEQFFTKPINDYTLPIKELSNWFDLLTVTKKREDIANLIKKL 622
            .:|||||||||.|.|...|:..:.||:: |..||....|..||::|.:||..|
Zfish   916 SSDCGLYLLQYAESFLQDPVVHFDLPLR-LERWFPRQQVRGKRDEIRDLILHL 967

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 43/281 (15%)
Peptidase_C48 396..585 CDD:304959 85/241 (35%)
si:dkey-100n23.3XP_005167827.1 ULP1 <678..939 CDD:227489 91/263 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107335053
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000927
OrthoInspector 1 1.000 T128811
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46896
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1602
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.