DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and senp3b

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001077311.1 Gene:senp3b ZFINID:ZDB-GENE-030131-6714 Length:515 Species:Danio rerio

Alignment Length:327 Identity:77/328 (23%)
Similarity:134/328 (41%) Gaps:97/328 (30%)


  Fly   285 GGSQSRVQSNVASISSPAVKATSDAAIPTPAERAERSRLRRNRNWI--LSRD------------V 335
            |.|||     |:|:|  .|:......:....:|.|.:....::.::  |..|            .
Zfish   220 GDSQS-----VSSLS--GVREYLSMPMKPTIQRIEMTLTEEHKAYVHGLIEDDLRKYGSLIPVHA 277

  Fly   336 DEDAVVLVSSGDEETTAADDGQTERRLSPDENQTLFTYP-PTGTGGLS----------ITIKDFM 389
            |:.|..|.|..:|     |..||.|:::  ....:.:|. .:||..:.          :|:.|..
Zfish   278 DDIAEQLQSIFNE-----DFSQTHRKMA--VQHLIQSYQRSSGTAMVKGFRVNYKRHVLTMDDLS 335

  Fly   390 CLSKGSYLNDIIIDFYLRWLKNNIIPEEQRDRTHIFSTFFHKRLTTRTNPRNTKQTAAQKRHERV 454
            .|...::|||.:::.|     .:::.:...::.|.|::||:.:|.|             |.::.|
Zfish   336 TLYGQNWLNDQVMNMY-----GDLVMDSVPEKVHFFNSFFYDKLRT-------------KGYDGV 382

  Fly   455 EKWTRNVNIFDKDFIIIPFNEQSHWILAIICYPNLRSPVVNNNNVQTTLSDDIPIKQPLILIFDS 519
            ::||:||:||.||.::||.:.:.||.|.                       .:.||:..|..|||
Zfish   383 KRWTKNVDIFQKDLLLIPIHLEVHWSLV-----------------------SVDIKRRSITYFDS 424

  Fly   520 LAVTSRHRAIAILRDYLTC-EHKAKYPNALAHVFNK-DNMPG----HSVEVPQQQNLTDCGLYLL 578
            ....:|.           | :|..||..|.|.:..| |.:.|    ..:.|.:|.|.:|||.::|
Zfish   425 QRTLNRR-----------CPKHIFKYLQAEAMIKEKRDFLTGWKGFFKMNVGRQNNDSDCGAFVL 478

  Fly   579 QY 580
            ||
Zfish   479 QY 480

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 9/34 (26%)
Peptidase_C48 396..585 CDD:304959 50/192 (26%)
senp3bNP_001077311.1 Peptidase_C48 341..513 CDD:280975 50/193 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.