DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and senp3a

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001098584.1 Gene:senp3a ZFINID:ZDB-GENE-030131-2303 Length:535 Species:Danio rerio

Alignment Length:419 Identity:91/420 (22%)
Similarity:155/420 (37%) Gaps:128/420 (30%)


  Fly   203 KKQKKCHIAKDNNGIQAASSH-DNPSS----SGNKQGSHNSTAITSNSTMTSNGLRGVQPAEDAP 262
            ::.::||..:     ...|.| ..|..    :|:.:|....|.| |:|..|:..|:|        
Zfish   186 RRVRRCHRRR-----YFGSQHFQRPPGRSLLNGDPEGRLQGTEI-SDSCSTNGALKG-------- 236

  Fly   263 AISQWIQSRNNAAVSKKSEETAGGSQSRVQSNVAS----ISSPAVKATSDAAIPTPAERAERSRL 323
                  :...:.||..:.|..|..:..:.|...||    :||..:.....               
Zfish   237 ------RDGLHGAVLGEREGRASPTNVQSQREKASLQNQLSSEHISCVQG--------------- 280

  Fly   324 RRNRNWILSRDVDEDAVVLVSSGDEETTAADDGQTERRLSPDEN---QTLFTYPPTGTG-----G 380
                  ||...:.:...::....||......:..||...||...   |.|.......:|     |
Zfish   281 ------ILDEFLQQYGSLIPIHVDEVVEKLQEIFTESFSSPHRKIMVQHLMQSYQRMSGSAMMRG 339

  Fly   381 LSITIK-------DFMCLSKGSYLNDIIIDFYLRWLKNNIIPEEQRDRTHIFSTFFHKRLTTRTN 438
            ..:..|       |...|...::|||.:::.|     .:::.:...::.|.|::||:.:|.|   
Zfish   340 FRVNYKRHVLVMDDLTTLYGQNWLNDQVMNMY-----GDLVMDAAPEKVHFFNSFFYDKLRT--- 396

  Fly   439 PRNTKQTAAQKRHERVEKWTRNVNIFDKDFIIIPFNEQSHWILAIICYPNLRSPVVNNNNVQTTL 503
                      |.:|.|::||:||:||.|.|::||.:.:.||  :::|                  
Zfish   397 ----------KGYEGVKRWTKNVDIFQKKFLLIPIHLEVHW--SLVC------------------ 431

  Fly   504 SDDIPIKQPLILIFDSLAVTSRHRAIAILRDYLTC-EHKAKYPNALA-HVFNKDNMPG----HSV 562
               :.:.|..:..|||....:|.           | :|.|||..|.| ....||...|    ..:
Zfish   432 ---VNVPQRSVTYFDSQRTLNRR-----------CPKHIAKYLQAEAIKREQKDFYTGWKGFFKM 482

  Fly   563 EVPQQQNLTDCGLYLLQY-----VEQFFT 586
            .|.:|.|.:|||.::|||     :||.|:
Zfish   483 NVARQNNDSDCGAFVLQYCKCLALEQPFS 511

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 23/125 (18%)
Peptidase_C48 396..585 CDD:304959 52/200 (26%)
senp3aNP_001098584.1 Peptidase_C48 361..533 CDD:280975 53/204 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.