DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and senp6a

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_021324231.1 Gene:senp6a ZFINID:ZDB-GENE-080204-25 Length:1036 Species:Danio rerio

Alignment Length:464 Identity:150/465 (32%)
Similarity:205/465 (44%) Gaps:139/465 (30%)


  Fly   272 NNAAVSK------KSEETAGGSQSRVQSNVA-SISSPAVKATSDA-AIPTP-AERAERSRLRRNR 327
            |.|::.|      |:|..|..|.|.:.:..: |:.:.||...:.| |:|.| |..:.::||... 
Zfish   575 NKASLEKEKVKVEKAEVVAAPSSSALLATPSLSVVTVAVAPVNTAPAVPVPCAAPSVQTRLSAR- 638

  Fly   328 NWILSRDVDEDAVVLVSSGDEETTAADDGQTERRLSPDENQTLFT--------Y-PPTGTGGLSI 383
               |....|:|        ||..               |.|..||        | ||...||:|:
Zfish   639 ---LQEFCDDD--------DEMA---------------ELQPTFTGPIIKLLVYPPPPAKGGISV 677

  Fly   384 TIKDFMCLSKGSYLNDIIIDFYLRWLKNNIIPEEQRDRTHIFSTFFHKRLTTRTNPRNTKQTAA- 447
            |.:|..|||.|.:|||:||||||::|....:.:|...|:|:||:||:|||..|.. |||..|:: 
Zfish   678 TNEDLHCLSDGEFLNDVIIDFYLKYLFLEKLKKEDAARSHVFSSFFYKRLNQRER-RNTVDTSSL 741

  Fly   448 --QKR-HERVEKWTRNVNIFDKDFIIIPFNEQSHWILAIICYPNLRSPVVNNNNV---QTTLSDD 506
              ||| |.||:.|||:|::|.||||.:|.||.:||.||:||:|.|.|..|..|.:   ||.:|..
Zfish   742 PIQKRKHNRVKTWTRHVDLFQKDFIFVPINESAHWYLAVICFPGLESAQVEPNPLYQPQTAVSSS 806

  Fly   507 IP--------------------------------------------------------------- 508
            .|                                                               
Zfish   807 PPTDGASEQRDQLSQNTAGPHRADANQVQFTDGLRRIIEYSTEDDSHQSDDQSSCQDECSEDGAL 871

  Fly   509 ------------------IKQPLILIFDSLAVTSRHRAIAILRDYLTCEHKAKYPNALAHVFNKD 555
                              .|||.|||.|||...:|...:..||:||..|.:.|  ......|.|:
Zfish   872 ADDSGSFDRAEWTSKPTICKQPCILIMDSLRGPTRSTVVKTLREYLEVEWEVK--KGSKRSFGKE 934

  Fly   556 NMPGHSVEVPQQQNLTDCGLYLLQYVEQFFTKPINDYTLPIKELSNWFDLLTVTKKREDIANLIK 620
            .|.|.|..||||.|.:|||:|:|||||.||..|:..:.||: .|..||....:..|||:|.:||.
Zfish   935 LMKGSSPRVPQQDNFSDCGVYVLQYVESFFESPLPSFHLPM-NLLEWFPQQRMKTKREEIKDLIL 998

  Fly   621 KLMNESNQQ 629
            ||  ::.||
Zfish   999 KL--QTQQQ 1005

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 16/56 (29%)
Peptidase_C48 396..585 CDD:304959 94/277 (34%)
senp6aXP_021324231.1 ULP1 <551..1002 CDD:227489 148/460 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000927
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46896
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.