DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and Senp18

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001002834.1 Gene:Senp18 RGDID:1303230 Length:475 Species:Rattus norvegicus

Alignment Length:520 Identity:108/521 (21%)
Similarity:183/521 (35%) Gaps:165/521 (32%)


  Fly   149 KPSETAVANNGCQPAASATKGKKHKKSPCGSPGENNDGQVILSADQDANTNTKA--------KKQ 205
            :|.:..|   |.:|.||..:.|:......|:..|:.    .|..:...|....|        |.:
  Rat     3 QPKQPGV---GMKPEASEQRRKRKHLDQNGTETESE----ALGPEPSRNCQDGAQMVFQKPGKAR 60

  Fly   206 KKCHIAKDNNGIQAASSHDNPSSSGNKQGSHNSTAITSNSTMTSNGLRGVQPAEDAP-------- 262
            ||.|....:..:       |....|..||....          ..|...::|.|..|        
  Rat    61 KKTHQEHQDQKL-------NKEQPGKGQGQKTQ----------DEGSGNIKPLEGLPDQAVVEKS 108

  Fly   263 ------------AISQWIQSRNNAAVSKKSEETAGGSQSR------------VQSNVASI-SSPA 302
                        .:.:..||..|...::..|...||...|            ..:|...: ..|.
  Rat   109 TEGGKCRKRPYSVLQEKPQSPQNEKHARSLEHLQGGHPVRSDPHRPHPTFSDTSNNKGGMPGHPH 173

  Fly   303 VKAT-------SDAAIPTPAER--AERSRLRRNRNWILSRDV--DEDAVVLVSSG---------- 346
            .:.|       |...:.|..|:  ||...:|.|.   |...:  ..:|.:|.|.|          
  Rat   174 GRETAHGDRQPSTEVLSTKREKRCAEEKCVRGNS---LEHGLPGTANANILDSGGGRLLPDKVAV 235

  Fly   347 ---------------DEETTAADDGQTERRLSPDENQTLFTYPPTGTG-GLSITIKDFMCLSKGS 395
                           ::|.|...:.:.|:.|.|...:.:.:     || .|.||..|...|..|.
  Rat   236 VAGEKNALPEQENNQEKEFTKEMEKEVEKALGPGAQEEILS-----TGFKLKITRGDMQTLKNGQ 295

  Fly   396 YLNDIIIDFYLRWLKNNIIPEEQRD----RTHIFSTFFHKRLTTRTNPRNTKQTAAQKRH---ER 453
            :|||.:|:||:     |::.:...:    ..|.|||||:.:|                :|   ..
  Rat   296 WLNDEVINFYM-----NLLVQRNENPGYPALHAFSTFFYAKL----------------KHGGYNS 339

  Fly   454 VEKWTRNVNIFDKDFIIIPFNEQSHWILAIICYPNLRSPVVNNNNVQTTLSDDIPIKQPLILIFD 518
            |::|||.:|:|:|:.|::|.:::.||.|.:                       |.:::..|:..|
  Rat   340 VKRWTRGINLFEKELILVPIHQRVHWSLVV-----------------------IDLRKRSIVYLD 381

  Fly   519 SLAVTSRHRAIAILRDYLTCEHKAKYPNALAHV-FNKDNMPGHSVEVPQQQNLTDCGLYLLQYVE 582
            |:..|.::....|.. ||..|.|.:....|..| :.:.::.  |.|:|||.|.:|||::..:|.:
  Rat   382 SMGQTGKNICETIFH-YLQNESKTRRNMELDPVEWKQYSLT--SQEIPQQLNGSDCGMFTCKYAD 443

  Fly   583  582
              Rat   444  443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 38/220 (17%)
Peptidase_C48 396..585 CDD:304959 49/196 (25%)
Senp18NP_001002834.1 Peptidase_C48 <244..470 CDD:304959 62/253 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.