DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and Gm5415

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001157758.1 Gene:Gm5415 MGIID:3644687 Length:478 Species:Mus musculus

Alignment Length:509 Identity:104/510 (20%)
Similarity:178/510 (35%) Gaps:181/510 (35%)


  Fly   134 PPN-AMAGEEHSPAVVKPSETAVANNGCQP----------------AASATKGKKHKKSPCGSPG 181
            ||: .:|.|:.|...|:.|:....|   ||                .|.|..||.||: |..:..
Mouse    59 PPDLELAIEQFSKGQVRKSQGETPN---QPKPLELTEGPPEQVVTGRAPADSGKGHKR-PYSAME 119

  Fly   182 ENNDGQVILSADQDANTNTKAKKQKKCHIAKD-------NNGIQAASSHDNPSSSGNKQGSHNST 239
            ||.  |:             .:|:||..:.::       ...|:...|.|:..|....:....||
Mouse   120 ENE--QI-------------PQKEKKRRLLQNLKLILIKAGKIKGGESEDSHGSETTLRDPEPST 169

  Fly   240 AITSNSTMTSN----------------------GLRG--VQPAEDAPAISQWIQSRNNAAVSKKS 280
            .:.....::.:                      |.||  ::|...|..|..  .||.|:.:..|.
Mouse   170 VVALKECLSPDEREKCCFEETSVTEKKGCVKVEGRRGNSLEPGTQAQIILD--SSRGNSLLPNKM 232

  Fly   281 EETAG-------GSQSRVQSNVASISSPAVKATSDAAIPTPAERAERSRLRRNRNWILSRDVDED 338
            ...|.       ..:.|....:..|:....|...:|..|.|.|....||.:              
Mouse   233 AVLAAQKKPLRDHEKHREMDQILDITEDMEKEIENALGPGPQEEILSSRFK-------------- 283

  Fly   339 AVVLVSSGDEETTAADDGQTERRLSPDENQTLFTYPPTGTGGLSITIKDFMCLSKGSYLNDIIID 403
              :|::.||.:|                                        |..|.:|||.:|:
Mouse   284 --LLITRGDIQT----------------------------------------LKNGQWLNDEVIN 306

  Fly   404 FYLRWLKNNIIPEEQRDR----THIFSTFFHKRLTTRTNPRNTKQTAAQKRHERVEKWTRNVNIF 464
            ||:     |::.|...::    .|:|||||:.:|             ....:..|::|||.:|:|
Mouse   307 FYM-----NLLVERNENQGYPALHVFSTFFYPKL-------------KHSGYSSVKRWTRGINLF 353

  Fly   465 DKDFIIIPFNEQSHWILAIICYPNLRSPVVNNNNVQTTLSDDIPIKQPLILIFDSLAVTSRHRAI 529
            :|:.|::|.:::.||.|.:                       |.:::..|..|||:..|.:....
Mouse   354 EKELILVPIHQRLHWSLVV-----------------------IDLRKQSIAYFDSIGQTGKSICE 395

  Fly   530 AILRDYLTCEHKAKYPNALAHV-FNKDNMPGHSVEVPQQQNLTDCGLYLLQYVE 582
            .|.: ||..|.|.:....|..: :.:.:|.  |.|:|.|.|.:|||::..:|.:
Mouse   396 TIFQ-YLQNESKTRRNIELDPLEWKQYSMA--SEEIPLQMNGSDCGMFTCKYAD 446

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 47/240 (20%)
Peptidase_C48 396..585 CDD:304959 49/193 (25%)
Gm5415NP_001157758.1 Peptidase_C48 <231..473 CDD:304959 66/317 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.