DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and velo

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_648056.1 Gene:velo FlyBaseID:FBgn0035713 Length:1833 Species:Drosophila melanogaster

Alignment Length:956 Identity:329/957 (34%)
Similarity:433/957 (45%) Gaps:310/957 (32%)


  Fly     7 VSKDQAVRRIAHNDFILVSRQLLINRAD---TDPDKGSARMLIIYSSGKQHIVTFKLPNLACRVQ 68
            |::..:|.:.:||::.:.|:.:|.|||.   .:.||.||:||:|.:||:|.::||.||..:|.||
  Fly   765 VTQGSSVMKTSHNNYEIHSQHVLNNRAGQEIAERDKNSAKMLVILASGEQRLITFTLPRESCTVQ 829

  Fly    69 DLFFQMDLQIDESTTIDCIENAGGIIHLVVSVGFPISDNIAETVAHAEEFYR------------- 120
            ||..|:.:..|.:|||.|:|:.|..:..||:|||.:.::.:|.::.|||..:             
  Fly   830 DLLEQVGVPFDHNTTIQCVEHRGANVDFVVTVGFTVHESASELISRAEESLQMNRSQENQAAVAG 894

  Fly   121 -----------------------KVHQSKASSADAAPPNAMAGEEHS--PAVVKPSE-------- 152
                                   ...|:|..:|.:|..|.:.|...|  .|...|||        
  Fly   895 AAAAANSNPATTSASPAYAQANAAAEQAKREAASSASGNTVVGTVSSAGSAGATPSEGRKLIDGF 959

  Fly   153 ---------TAVANNGCQ------PAASATKGKKHKKSPCGSPGENNDGQVILSADQDANTNTKA 202
                     |.|.:..|:      |.....|....|.|...||..::..:.:.:..      |.|
  Fly   960 LAVCQLCGFTGVDHARCERCKRVFPEPPKRKSYVPKNSAASSPASSSSSEPVSAVP------TAA 1018

  Fly   203 KKQKKCHIAKDNNGIQAA------------------------------------SSHDNPSSSGN 231
            .|:::...|:.||.:..|                                    ||.|  .:.|.
  Fly  1019 DKKRELAAARFNNKMAGANFAVGVGVRGRGSMAMRGGRARGGRRVPEVDPVVLLSSED--EAEGG 1081

  Fly   232 KQGSHNSTAITSNSTMTSNG---------------------------LRG-VQPAEDAPAISQWI 268
            :..|.:|...|:||.:.|||                           .|| |:...|.|...|:.
  Fly  1082 EGTSDSSNQPTNNSKLNSNGNLHELSAAFPCEPNLPEIDEEPLYKDFSRGDVRDLSDIPEADQFS 1146

  Fly   269 QSRNNAAV---------------SKKSEETAG---GSQSRVQSNVASIS-----------SPAVK 304
            .|...:.|               :.|....||   ....:.:.|:....           .||..
  Fly  1147 ASLKCSCVRLVPYRFEITEPVCFTTKGVRIAGILKDKDEKFELNIHKQEVIKVIAHFGNVEPAQP 1211

  Fly   305 ATSDAAIPTPAERAE----------------RSRLRRNRNWILSRD----------------VDE 337
            ..:...:.|.||..:                ::.....|..||..|                |||
  Fly  1212 LVTLYLLKTCAEYVKNQLKLPDDQHHEHTGFKTHSYHTRRLILLFDSISVSARGNIKSMFSCVDE 1276

  Fly   338 ----DAVVL---VSSGDEETTAADDGQTERRLSPDENQTLFTYPPTGTGGLSITIKDFMCLSKGS 395
                ||..:   ::..|.:|.........|:|..||..:|..|||.|||||.|.::||:||:|.|
  Fly  1277 ISSTDAAEILERIADSDRKTQDKSSQPPPRQLRADEQVSLLMYPPKGTGGLCIRMEDFVCLTKES 1341

  Fly   396 YLNDIIIDFYLRWLKNNIIPEEQRDRTHIFSTFFHKRLTTRTNPRNTKQTAAQKRHERVEKWTRN 460
            |||||||||||.||:|.:|||.||:|||||||||:|||||.|.|.:.|||||||||.||:|||:.
  Fly  1342 YLNDIIIDFYLLWLRNTLIPEPQRERTHIFSTFFYKRLTTLTRPADMKQTAAQKRHARVQKWTKG 1406

  Fly   461 VNIFDKDFIIIPFNEQSHWILAIICYPNLRSPVV------------------------------- 494
            |:||||||||:|.||||||.|||||||||:.||.                               
  Fly  1407 VDIFDKDFIIVPINEQSHWFLAIICYPNLKGPVTFDTNQPVEPQQLKRPRGKKVALQIGNTTITP 1471

  Fly   495 ---------------------------------------------NNNNVQ--------TT---- 502
                                                         |:|:.:        ||    
  Fly  1472 LTKRAEGGQLPAALTAENVCRIADDESERDEAEGDESDMASEDSENSNSAKEPAATPTSTTASTP 1536

  Fly   503 ----------------LSDDIP-IKQPLILIFDSLAVTSRHRAIAILRDYLTCEHKAKYPNALAH 550
                            .|||:| :||||||||||||..||.|.:|.||||||||::.|.|:|.||
  Fly  1537 SLSSSQPTATGPARNIASDDVPAVKQPLILIFDSLAGASRSRVVATLRDYLTCEYRVKKPDAQAH 1601

  Fly   551 VFNKDNMPGHSVEVPQQQNLTDCGLYLLQYVEQFFTKPINDYTLPIKELSNWFDLLTVTKKREDI 615
            ||||||||||.|:||||.|.|||||||||||||||.:||.||.||||:|:||||.||||||||||
  Fly  1602 VFNKDNMPGHCVKVPQQNNFTDCGLYLLQYVEQFFGEPIRDYRLPIKQLTNWFDFLTVTKKREDI 1666

  Fly   616 ANLIKKLMNESN-QQRKILPVIKFPTLNGQLVMDEEDSEEENSKEE 660
            ||||::||:|.| |||.|||||:|||||||||...||:|....:||
  Fly  1667 ANLIQQLMDEGNQQQRLILPVIEFPTLNGQLVEYPEDTESAEFEEE 1712

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 56/315 (18%)
Peptidase_C48 396..585 CDD:304959 143/294 (49%)
veloNP_648056.1 Peptidase_C48 1342..>1434 CDD:304959 72/92 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2214
Isobase 1 0.950 0 Normalized mean entropy S6692
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000927
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46896
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1602
66.030

Return to query results.
Submit another query.