DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and CG11023

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_787955.2 Gene:CG11023 FlyBaseID:FBgn0031208 Length:480 Species:Drosophila melanogaster

Alignment Length:392 Identity:84/393 (21%)
Similarity:149/393 (38%) Gaps:95/393 (24%)


  Fly   227 SSSGNKQGSHNSTAITSNSTM----TSNGLRGVQPAEDAPA---------------------ISQ 266
            ::..|..|||.:..:|.||.:    .:|.....||....|.                     .::
  Fly   117 AAQSNSVGSHYAEPVTDNSEVKKVSETNKSDAPQPLTPQPTRLTRTESLHRRFASCVNLNDDFAE 181

  Fly   267 WIQSRNNAAVSKKSEETAGGSQSRVQSNVASISS-PAVKATSDAAIPTPAERAERSRLRRNRNWI 330
            ..::|......|.........:.|:.||.::|.: ..::|.....:    |...:|.:.....::
  Fly   182 QFKARAADCEEKSKHRLRLAEEQRLFSNFSAIKNIDELRAYERKVV----ENIFQSCIAHKPIFV 242

  Fly   331 LSRDVDEDAVVLVSSGDEETTAADDGQTERRLSPDENQT--LFTYPPTGTGGLSITIKDFMCLSK 393
            |. .:|:..|..|:.....|....|...|  ::.|:..|  :|.:      .|.||.:|......
  Fly   243 LG-PLDKPNVKKVTKLIPLTEEHHDRFNE--ITQDDKSTEIIFKF------NLHITTEDICTFIN 298

  Fly   394 GSYLNDIIIDFYLRWL------KNNIIPEEQRDRTHIFSTFFHKRLTTRTNPRNTKQTAAQKRHE 452
            |.:|||.:|:||:..|      ::.::|     .|:..:|||..||             .|..|.
  Fly   299 GKWLNDEVINFYMSLLTERSEKRSGVLP-----ATYAINTFFVPRL-------------LQAGHA 345

  Fly   453 RVEKWTRNVNIFDKDFIIIPFN-EQSHWILAIICYPNLRSPVVNNNNVQTTLSDDIPIKQPLILI 516
            .:::|||.|::|.||.|.:|.: ...||.:|||   :||:..:.                    .
  Fly   346 GIKRWTRKVDLFSKDIIPVPVHCNGVHWCMAII---HLRNKTIR--------------------Y 387

  Fly   517 FDSLAVTSRHRAIAILRDYLTCEHKAKYPNALAHVFNKDNMPGHSVE-VPQQQNLTDCGLYLLQY 580
            :||....:| ..:..|..||..|...|....    |:..:....||: :|:|.:.:|||::...:
  Fly   388 YDSKGKPNR-PVLDALEKYLREESIFKPKKQ----FDTSDFVIESVQNIPRQLDGSDCGIFSCMF 447

  Fly   581 VE 582
            .|
  Fly   448 AE 449

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 19/118 (16%)
Peptidase_C48 396..585 CDD:304959 49/196 (25%)
CG11023NP_787955.2 Peptidase_C48 300..475 CDD:280975 49/197 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.