DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and Senp5

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001344016.1 Gene:Senp5 MGIID:2443596 Length:749 Species:Mus musculus

Alignment Length:758 Identity:146/759 (19%)
Similarity:230/759 (30%) Gaps:313/759 (41%)


  Fly    13 VRRIAHNDFILVSRQLLINRADTDPDKGSARMLIIYSSGKQHIVTFKLPNLACRVQDLFFQMDLQ 77
            |:|.....||..||.||..:||.           :.||.|      .|.:..||.:.|       
Mouse    95 VKRKDSKHFISSSRSLLKLQADK-----------LLSSAK------SLDHKYCREKSL------- 135

  Fly    78 IDESTTIDCIENAGGIIHLVVSVGFPISDNIAETVAHAEEFYRKVHQSKASSADAAPPNAMAGEE 142
                     ::.|.|:              .|.||......:......:||..    |...:||.
Mouse   136 ---------LKAAPGL--------------SANTVLGRANGHEPTTDPQASDF----PMKFSGES 173

  Fly   143 HSPAVVKPSETAVANNGCQPAASATKGKKHKKSPC-----GSPGENNDGQVI------------- 189
            .||.  ...:|.|.|             ||:|..|     |.....|...:|             
Mouse   174 QSPG--DSGKTVVLN-------------KHRKRVCHGCYQGLEHHRNRRPLIPKQFQLNQHRRVR 223

  Fly   190 -----------------LSADQDANTNTKAKKQKKCHIA-------------KDNNGIQAASSHD 224
                             :...|...|.::..|.:|...:             :|||   ....:.
Mouse   224 ASLMMYEKLSMIRFRYRIFRSQHFRTKSRVCKLRKAQRSWVQKVTGDHQENLRDNN---TEGDNC 285

  Fly   225 NP---------------------SSSGNKQGSHNSTAITSNSTM--TSNGLRGVQPAEDAPAIS- 265
            ||                     |:.|..:..|.....|..:.:  ..:||....|.:....:: 
Mouse   286 NPVPSLEPKDPCRCQPYFPDMDSSAVGKGKNCHVPDGHTKENPVLDKEHGLDDTFPDQQNGCVAY 350

  Fly   266 QWIQSRN-----------------NAAVSKKSEETAGGSQSRVQ-SNVASIS--------SPAVK 304
            .|.||.:                 :.:..|.|.||.....:..| |..:::|        |.|.|
Mouse   351 NWDQSSSCPKWECTEQIHEIPLMEHPSSDKFSPETERALMALGQESGTSAVSDDREKLPVSGADK 415

  Fly   305 ATSDAAIPTPAERAERSRLRRNRNWILSRDV------DE-------DAVVL---------VSSGD 347
            :.|....|...|.|:....:...:..|.:.:      |.       ||.:|         :|.|.
Mouse   416 SVSSVDGPVSEEPAQNENFQMEEDGSLKQSILSSKLLDHPYCKSPLDAPLLCSEPKVENQMSGGK 480

  Fly   348 EETTAA--DDGQTERRLSPDENQTLFTYPPTGTGGL----------------------------- 381
            ...||:  ||.|....||...::.:..|     |.|                             
Mouse   481 SSQTASPVDDEQLSTCLSGFLDEVMKKY-----GSLVPLSEKDVLGRLKDVFNEDFSNRKPFINR 540

  Fly   382 ---------------------SITIKDFMCLSKGSYLNDIIIDFYLRWLKNNIIPEEQRDRTHIF 425
                                 .:.:.|...|...::|||.:|:.|     ..:|.:...|:.|.|
Mouse   541 EITNYRARHQKCNFRIFYNKHMLDMDDLATLDGQNWLNDQVINMY-----GELIMDAVPDKVHFF 600

  Fly   426 STFFHKRLTTRTNPRNTKQTAAQKRHERVEKWTRNVNIFDKDFIIIPFNEQSHWILAIICYPNLR 490
            ::|||::|.|             |.:..|::||:.|::|.|..::||.:.:.||.|         
Mouse   601 NSFFHRQLVT-------------KGYNGVKRWTKKVDLFKKSLLLIPIHLEVHWSL--------- 643

  Fly   491 SPVVNNNNVQTTLSDDIPIKQPLILIFDSLAVTSRHRAIAILRDYLTCEHKAKYPNALAHVFNKD 555
                    :..|||..|      |..:||..:..:. .:..:|.||..|.:.|            
Mouse   644 --------ITVTLSSRI------ISFYDSQGIHFKF-CVENIRKYLLTEAREK------------ 681

  Fly   556 NMP----GHSVEV----PQQQNLTDCGLYLLQY-----VEQFF 585
            |.|    |....|    |||:|.:|||:::|||     :||.|
Mouse   682 NRPEFLQGWQTAVTKCIPQQKNDSDCGVFVLQYCKCLALEQPF 724

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 50/295 (17%)
Peptidase_C48 396..585 CDD:304959 54/202 (27%)
Senp5NP_001344016.1 Protease 557..718 54/215 (25%)
Peptidase_C48 575..747 CDD:308514 55/205 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.