DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and Senp3

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001013134.2 Gene:Senp3 RGDID:1312040 Length:568 Species:Rattus norvegicus

Alignment Length:392 Identity:84/393 (21%)
Similarity:151/393 (38%) Gaps:114/393 (29%)


  Fly   247 MTSNGLRGVQPAEDAPAISQ----WIQSR----NNAAVSKKSEETAGG-------------SQSR 290
            |..:|:||..|....|.:.:    |....    ::..:|.......||             ..|.
  Rat   198 MAEDGMRGSPPVPSGPPMEEDGLRWTPKSPLDPDSGLLSCTLPNGFGGLSGPEGERSLAPPDASI 262

  Fly   291 VQSNVASISSPAVK--------ATSDAAIPTPAERA-ERSRLRRNRNWILSRDVDE-----DAVV 341
            :.|||.||.....:        .|::.| ..|.|:| :.|.||......:...:||     .:::
  Rat   263 LISNVCSIGDHVAQELFQSSDLGTAEEA-DRPGEKAGQHSPLREEHVTCVQSILDEFLQTYGSLI 326

  Fly   342 LVSSGDEETTAADDGQTERRLSPDEN----QTLFTYPPTGTGGL-----------SITIKDFMCL 391
            .:|: ||.....:|...:...:|...    |.:.:|.......:           .:|:.|...|
  Rat   327 PLST-DEVVEKLEDIFQQEFSTPSRKSLVLQLIQSYQRMPGNAMVRGFRVSYKRHVLTMDDLGTL 390

  Fly   392 SKGSYLNDIIIDFYLRWLKNNIIPEEQRDRTHIFSTFFHKRLTTRTNPRNTKQTAAQKRHERVEK 456
            ...::|||.:::.|     .:::.:...::.|.|::||:.:|.|             |.::.|::
  Rat   391 YGQNWLNDQVMNMY-----GDLVMDTVPEKVHFFNSFFYDKLRT-------------KGYDGVKR 437

  Fly   457 WTRNVNIFDKDFIIIPFNEQSHWILAIICYPNLRSPVVNNNNVQTTLSDDIPIKQPLILIFDSLA 521
            ||:||:||:|:.::||.:.:.||.|.                       .:.:::..|..|||..
  Rat   438 WTKNVDIFNKELLLIPIHLEVHWSLV-----------------------SVDVRRRTITYFDSQR 479

  Fly   522 VTSRHRAIAILRDYLTC-EHKAKYPNALAHVFNKDNMPGH-------SVEVPQQQNLTDCGLYLL 578
            ..:|.           | :|.|||..|.|  ..||.:..|       .:.|.:|.|.:|||.::|
  Rat   480 TLNRR-----------CPKHIAKYLQAEA--VKKDRLDFHQGWKGYFKMNVARQNNDSDCGAFVL 531

  Fly   579 QY 580
            ||
  Rat   532 QY 533

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 21/102 (21%)
Peptidase_C48 396..585 CDD:304959 48/194 (25%)
Senp3NP_001013134.2 Peptidase_C48 394..566 CDD:280975 48/195 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.