DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and Senp6

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001100312.2 Gene:Senp6 RGDID:1304565 Length:1135 Species:Rattus norvegicus

Alignment Length:1009 Identity:212/1010 (21%)
Similarity:334/1010 (33%) Gaps:427/1010 (42%)


  Fly     2 DRKETVSKDQAVRRIAHNDFIL--------VSRQLLINRADTDPD-KGSARMLIIYSSGKQHIVT 57
            ||||.......|.:..:|..:|        |.::...:.:..:|: |...:.       |:|..|
  Rat   154 DRKERKEYPPHVHKAENNPVMLSHGQGGDHVMKKTEDSESYVEPEVKRKVQQ-------KRHCST 211

  Fly    58 FKLPNLA-------------------------------CRVQDLFFQMDLQIDESTTIDCIENAG 91
            ::|..|:                               |:...:.|..|||.:....:...|:.|
  Rat   212 YQLSPLSPASKKCLTHFEVSEQRECCPKCGKEKENQTRCQSCGIVFHNDLQRNCRQAVTLNESTG 276

  Fly    92 GIIHLVV--SVGFPISDNIAETVAHAEEFYRKVHQSKASSADAAPPNAMA---GEEHSPAVVKPS 151
            .::...:  :.|...|.|...|   |::||       .:|.|..|.:.:.   |..|:  .::.:
  Rat   277 PLLRTSIHQNSGGQKSQNTGLT---AKKFY-------GNSVDKIPIDILLTCDGSRHN--YIQTN 329

  Fly   152 ETAVANNGCQPAASATKGKKHKKSPCGSPGENNDGQVILSADQDANTNTKAKKQKKCHIAKDNNG 216
            ...:...|..|..:..|.:|...|....|       :|||:|.|.:.:...:::.......|:  
  Rat   330 GKVILPGGKIPKITNPKERKTSVSDLNDP-------IILSSDDDDDDDRTKRRESTSPQPADS-- 385

  Fly   217 IQAASSHDNPSSSGNKQGSHNSTAITSNSTMTSNGLRGVQPAEDAPAISQWIQSRNNAAVSKKS- 280
              |.||   |:.|..|          ..:.:.:|..|..|....:||.|:    .|...:.:|: 
  Rat   386 --ACSS---PAPSTGK----------VEAALNANTCRAEQEPRSSPAESE----LNTVVIPRKAR 431

  Fly   281 -EETAGGSQS------RVQSN-----VASIS------------------------SPAVKA---- 305
             ::..|.|.|      :|.::     |.|:|                        .|.:.:    
  Rat   432 MKDQLGNSISTPLKRRKVNTHGALIPVTSLSCQDFGSVILNCRSIRVGTLFRLLVEPVIFSLELI 496

  Fly   306 ---------------TSD-----------------AAIPTPAER--AERSRLRRNRNW------- 329
                           |||                 .|||...::  .:....:.::.|       
  Rat   497 KIRLDGPDSVEIILNTSDLTKCEWCNVRKLPVVFLQAIPAVYQKLSLQLQMSKEDKVWNDCKGIN 561

  Fly   330 ------------ILSRDVDEDAVVLVSS--------------------------------GDEET 350
                        |....:|..|.|:..|                                ..||:
  Rat   562 RITSLEEQYIILIFQTGLDHQADVVFESIITDIGIRNNVCNFFAKIPFEEANSRLVACTRSYEES 626

  Fly   351 TAADDGQTERRL------------------------SPDENQTLF--------TY-PPTGTGGLS 382
            ...:..|.|.::                        ...|:.|:|        .| ||...||:|
  Rat   627 IKGNCVQKENKVKTVSFESKIQLRSKQELQFFDDEEEAGESHTIFIGPVEKLIVYPPPPAKGGIS 691

  Fly   383 ITIKDFMCLSKGSYLNDIIIDFYLRWLKNNIIPEEQRDRTHIFSTFFHKRLT--TRTNPRNTKQT 445
            :|.:|..|||:|.:|||:||||||::|....:.:|..||.||||:||:|||.  .|.|...|..:
  Rat   692 VTNEDLHCLSEGEFLNDVIIDFYLKYLVLEKLKKEDADRIHIFSSFFYKRLNQRERRNSETTNLS 756

  Fly   446 AAQKRHERVEKWTRNVNIFDKDFIIIPFNEQSHWILAIICYPNLRSPVVNNN------------- 497
            ..||||.||:.|||:|:||:||||.:|.||.:||.||::|:|.|..|....|             
  Rat   757 IQQKRHGRVKTWTRHVDIFEKDFIFVPLNEAAHWFLAVVCFPGLEKPKYEPNPHYHENAVMQKPS 821

  Fly   498 ---------------------------------------------------------NVQTTL-- 503
                                                                     :|:.::  
  Rat   822 RAEDSYVSSASEVDACSQNSAAKPVIKKMLHRKHCLAVTDSSAAQEDSEPCYRRNAYSVKCSMKK 886

  Fly   504 ----------------------------------------------------------------- 503
                                                                             
  Rat   887 KNHAVHENEEPSNGESACQEISDRTESEHGLQDECLNSAHHPDALSKIRLNYGDQSAEGGKLLED 951

  Fly   504 ---------------SDD-------------------IPIKQPLILIFDSLAVTSRHRAIAILRD 534
                           |||                   ...|||.||:.|||...||...:.|||:
  Rat   952 ELIDFSEDQDDPDDSSDDGLLADENYNSEIGQWHLKPTVCKQPCILLMDSLRGPSRSNVVKILRE 1016

  Fly   535 YLTCEHKAKYPNALAHVFNKDNMPGHSVEVPQQQNLTDCGLYLLQYVEQFFTKPINDYTLPIKEL 599
            ||..|.:.|  ......|:||.|.|.:.:||||.|.:|||:|:|||||.||..||.::.||: .|
  Rat  1017 YLEVEWEVK--KGSKRSFSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPILNFELPM-NL 1078

  Fly   600 SNWFDLLTVTKKREDIANLIKKLMNESNQQRKIL 633
            .|||....:..|||:|.|:|.||..|.::::::|
  Rat  1079 VNWFPPPRMKTKREEIRNIILKLQEEQSKEKRLL 1112

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 45/275 (16%)
Peptidase_C48 396..585 CDD:304959 94/362 (26%)
Senp6NP_001100312.2 Peptidase_C48 704..>816 CDD:304959 53/112 (47%)
Peptidase_C48 <996..1072 CDD:304959 37/78 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107338994
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000927
OrthoInspector 1 1.000 T618955
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46896
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
65.890

Return to query results.
Submit another query.