DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and Senp1

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_017450802.1 Gene:Senp1 RGDID:1310275 Length:724 Species:Rattus norvegicus

Alignment Length:541 Identity:116/542 (21%)
Similarity:207/542 (38%) Gaps:141/542 (26%)


  Fly   110 ETVAHAE-EFYRKVHQSKASSADAAPPNAMAGEEHSPAVVKP--------SETAVANNGCQPAAS 165
            |||...| |.||::.|            .:.|::.|  |.||        |....:|......:.
  Rat   242 ETVQEEEKEIYRQLLQ------------MVTGKQFS--VAKPTTHFPLHLSRCLSSNKNSLKDSL 292

  Fly   166 ATKGKKHKKSPCGSPGENNDGQVILSADQDANTNTKAKKQKKCHIA---KD---NNGIQAASSHD 224
            ...|........||...::....||:|.:..:.:..:.......:|   ||   ::.:.|....|
  Rat   293 LRNGNSCASHVIGSDTSSSGSASILTAQEQLSHSAHSLISGTPDVAFGSKDSALHHHLSAPHQPD 357

  Fly   225 N-PSSSGNKQGSHNSTAITSNSTMTSNGLRGVQPAE------------------DAPAISQ---W 267
            : |:|:...:||.:...:....:.|. ..|.:.|.:                  .:|...|   |
  Rat   358 SLPASNPQSEGSDSVILLKVKESQTP-ASRYLSPLKRSTCPYIIPYSAVTDLLSSSPTFFQAELW 421

  Fly   268 IQ-------SRNNAAVSKKSEETAGGSQSRVQSNVASISSPAVKATSDAAIPTPAER------AE 319
            |:       ||....:.:..|:.|...|  :|:........||..:.:..:..|.|:      |:
  Rat   422 IKELTSVYDSRARERLRQIEEQKALALQ--LQNQRLQEQEHAVLDSVELHLRVPLEKEVPVTAAQ 484

  Fly   320 RSRLRRNRNWILSRDVDEDAVVLVSSGDEETTAADDGQTERRLSPDENQTLFTYPPTGTGGLSIT 384
            .:|.:.::   |:...||...:......|......:|..:..||.             ...|:||
  Rat   485 ETRKKSHQ---LTDSEDEFPEITEEMEKEIKNVFRNGNQDEVLSE-------------AFRLTIT 533

  Fly   385 IKDFMCLSKGSYLNDIIIDFYLRWLKNNIIPEEQRDR----THIFSTFFHKRLTTRTNPRNTKQT 445
            .||...|:..::|||.||:||:     |::.|..:::    .|.|:|||.           ||..
  Rat   534 RKDIQTLNHLNWLNDEIINFYM-----NMLMERSKEKGFPSVHAFNTFFF-----------TKLK 582

  Fly   446 AAQKRHERVEKWTRNVNIFDKDFIIIPFNEQSHWILAIICYPNLRSPVVNNNNVQTTLSDDIPIK 510
            ||  .::.|::||:.|::|..|.:::|.:...||.||::.:                       :
  Rat   583 AA--GYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDF-----------------------R 622

  Fly   511 QPLILIFDSLAVTSRHRAIAILRDYLTCE----HKAKYPNALAHVFNKDNMPGHSVEVPQQQNLT 571
            :..:..:||:...: :.|..||..||..|    .:.::......:|:|     .|.|:|||.|.:
  Rat   623 KKSVTYYDSMGGVN-NEACRILLQYLKQESVDKKRKEFDTNGWQLFSK-----KSQEIPQQMNGS 681

  Fly   572 DCGLYLLQYVEQFFTK--PIN 590
            |||::..:|.: ..||  |||
  Rat   682 DCGMFACKYAD-CITKDRPIN 701

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 41/246 (17%)
Peptidase_C48 396..585 CDD:304959 49/197 (25%)
Senp1XP_017450802.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.