DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and SENP1

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_016874718.1 Gene:SENP1 HGNCID:17927 Length:707 Species:Homo sapiens

Alignment Length:472 Identity:98/473 (21%)
Similarity:179/473 (38%) Gaps:155/473 (33%)


  Fly   200 TKAKKQKKCHIAKDNNGIQAASSHDNPSSSGN-------KQGSHNSTAITSNSTMTSNGLRGVQP 257
            :.:|...|..:.|:.|...:.....:.||||:       :|.||:..:::|.:...:.|      
Human   287 SSSKNTLKDSLFKNGNSCASQIIGSDTSSSGSASILTNQEQLSHSVYSLSSYTPDVAFG------ 345

  Fly   258 AEDAPAI-------SQWIQSRNNAAVSKKSEETAGGSQSRVQSNVASISSPAVKATSDAAIPTPA 315
            ::|:..:       |...|..|.||.:.:||    ||.|.:...|           .|:..|||:
Human   346 SKDSGTLHHPHHHHSVPHQPDNLAASNTQSE----GSDSVILLKV-----------KDSQTPTPS 395

  Fly   316 ERAERSRLRRNRNWILS-------------RDVDEDAVVLVSSGDE-----ETTAADDGQTERRL 362
            ....::.|     ||..             |.::|...:.:...::     |.:..|..:...|:
Human   396 STFFQAEL-----WIKELTSVYDSRARERLRQIEEQKALALQLQNQRLQEREHSVHDSVELHLRV 455

  Fly   363 SPDENQTLFTYPPTGTGG---------------------------------------LSITIKDF 388
            ..::...:.....|...|                                       |:||.||.
Human   456 PLEKEIPVTVVQETQKKGHKLTDSEDEFPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDI 520

  Fly   389 MCLSKGSYLNDIIIDFYLRWLKNNIIPEEQRDR----THIFSTFFHKRLTTRTNPRNTKQTAAQK 449
            ..|:..::|||.||:||:     |::.|..:::    .|.|:|||..:|.|             .
Human   521 QTLNHLNWLNDEIINFYM-----NMLMERSKEKGLPSVHAFNTFFFTKLKT-------------A 567

  Fly   450 RHERVEKWTRNVNIFDKDFIIIPFNEQSHWILAIICYPNLRSPVVNNNNVQTTLSDDIPIKQPLI 514
            .::.|::||:.|::|..|.:::|.:...||.||::.:                       ::..|
Human   568 GYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDF-----------------------RKKNI 609

  Fly   515 LIFDSLAVTSRHRAIAILRDYLTCE----HKAKYPNALAHVFNKDNMPGHSVEVPQQQNLTDCGL 575
            ..:||:...: :.|..||..||..|    .:.::......:|:|     .|.|:|||.|.:|||:
Human   610 TYYDSMGGIN-NEACRILLQYLKQESIDKKRKEFDTNGWQLFSK-----KSQEIPQQMNGSDCGM 668

  Fly   576 YLLQYVEQFFTK--PIN 590
            :..:|.: ..||  |||
Human   669 FACKYAD-CITKDRPIN 684

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 29/133 (22%)
Peptidase_C48 396..585 CDD:304959 48/197 (24%)
SENP1XP_016874718.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.