DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and Senp7

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_006248306.1 Gene:Senp7 RGDID:1305510 Length:1043 Species:Rattus norvegicus

Alignment Length:750 Identity:195/750 (26%)
Similarity:296/750 (39%) Gaps:237/750 (32%)


  Fly   102 FPISDNIAETVAHAEEFYR----------KVHQSKASS-ADAAPP-------------------- 135
            |..|.|...:|..:.|:.:          |:.:|...| .|.|||                    
  Rat   307 FHNSHNPKSSVDKSTEYIKEEENESTVSSKLEESNEDSHQDPAPPEGLTPDSLETEATNVCSFVV 371

  Fly   136 -----NAMAGEEHSPAVVKPSETAVANNGCQPAASATKGKKHKKSPCGSPGENNDGQ-------- 187
                 :|.:|...||.  |.||::|::...:.:::|.||:.........||.|::..        
  Rat   372 QEPDVSAASGRACSPN--KSSESSVSSEVAENSSAAEKGEASTVKEAPPPGGNSEENQLLMSAEP 434

  Fly   188 VILSADQDANTNTKAKKQKKCHIAKDN----------------------NGIQAAS--------- 221
            :::|:|::.....|.....|...::|.                      ..:|.:|         
  Rat   435 IVVSSDEEGPVEHKNSVILKLQPSQDYEFMSENQTTSDPQLSELMLGACESVQVSSELCPYNPDM 499

  Fly   222 ---SHDNPSS------------------SGNKQG---------------SHNSTAITSNST---- 246
               |..||:|                  .|..:|               |.|..::|.::.    
  Rat   500 ENISCINPNSEMDLKLDFIFTCVYIGKIKGTSKGCITFTKKYIKIPFQVSMNEISLTVDTARLKR 564

  Fly   247 ----------------------MTSNGLRGVQPAEDAPAISQWIQSRN------NAAVSKKSE-- 281
                                  ::||.|:.:|...:.|.:||..::..      |:.:|::.|  
  Rat   565 FGLWESKDDDHSKRSHAILFLWVSSNYLQDIQTQLENPMLSQQSKANEFIFLELNSPISQREELK 629

  Fly   282 -----ETAGGSQSRVQSN--------------------------VASISS-PAVKATSDAAIPTP 314
                 ...|.:...:|.:                          .||.|| ||| |.:|......
  Rat   630 LKDIMMEIGATNGELQLSCPLPWVQAFPLFQDLSPQEISFLHYYCASASSFPAV-AGADMKKKPV 693

  Fly   315 AERAERSRLRRNRNWILSRDVDEDAVVLVSSGDEETTAADDGQTERRLSPDENQTLFTYPPTGT- 378
            ::.:....::....::..:.....::.:.||.|||      .:..|...|  .|.|..|||..| 
  Rat   694 SQPSNADVVKPTYTFLHKQSSGCYSLSITSSPDEE------WREVRNTGP--VQKLIVYPPPPTK 750

  Fly   379 GGLSITIKDFMCLSKGSYLNDIIIDFYLRWLKNNIIPEEQRDRTHIFSTFFHKRLTTRTN---PR 440
            |||.:|.:|..||.:|.:|||:||||||::|......:|..:|:||||:||:|.||.:.|   ..
  Rat   751 GGLGVTNEDLECLEEGEFLNDVIIDFYLKYLLLEKASDELVERSHIFSSFFYKCLTRKENNLTED 815

  Fly   441 NTKQTAAQKRHERVEKWTRNVNIFDKDFIIIPFNEQSHWILAIICYPNLRSPVVN---------- 495
            |...:.||:||.||..|||::|||:||:|.:|.||.|||.||:||:|.|...|..          
  Rat   816 NPDLSVAQRRHRRVRTWTRHINIFNKDYIFVPVNESSHWYLAVICFPWLEEAVYEDFPQTVSQEF 880

  Fly   496 ------------NNNVQTT--------------LSDDIP---IKQPLILIFDSLAVTSRHRAIAI 531
                        :|:..||              .|..:|   .|:|.|||.|||...|....:..
  Rat   881 QDQQSQHDNKTIDNDPHTTSTVFTSAEESQSTETSMSVPKKMCKRPCILILDSLKAASIQNTVQN 945

  Fly   532 LRDYLTCEHKAKYPNALAHVFNKDNMPGHSVEVPQQQNLTDCGLYLLQYVEQFFTKPINDYTLPI 596
            ||:||..|.:.|  ......|:|.||.....:||:|.|.:|||:|||||||.||..||.::.|||
  Rat   946 LREYLEVEWEVK--RKTHREFSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFQDPIVNFELPI 1008

  Fly   597 KELSNWFDLLTVTKKREDIANLIKKLMNESNQQRK 631
             .|..||....:..|||||..||.||   ..||:|
  Rat  1009 -HLEKWFPRHVIKTKREDIRELILKL---HLQQQK 1039

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 57/364 (16%)
Peptidase_C48 396..585 CDD:304959 90/231 (39%)
Senp7XP_006248306.1 Peptidase_C48 767..1004 CDD:304959 93/239 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107335713
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000927
OrthoInspector 1 1.000 T619133
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46896
Phylome 1 0.910 0.917 Consistency score
TreeFam 1 0.960
76.800

Return to query results.
Submit another query.