DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and SENP3

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_056485.2 Gene:SENP3 HGNCID:17862 Length:574 Species:Homo sapiens

Alignment Length:391 Identity:84/392 (21%)
Similarity:149/392 (38%) Gaps:112/392 (29%)


  Fly   247 MTSNGLRGVQPAEDAPAISQ----WIQSR----NNAAVSKKSEETAGGSQ-------------SR 290
            |..:|:||..|....|.:.:    |....    ::..:|.......||..             |.
Human   204 MAEDGVRGSPPVPSGPPMEEDGLRWTPKSPLDPDSGLLSCTLPNGFGGQSGPEGERSLAPPDASI 268

  Fly   291 VQSNVASISSPAVKAT---SDAAIPTPAER-----AERSRLRRNRNWILSRDVDE-----DAVVL 342
            :.|||.||.....:..   ||..:...|||     .:.|.||......:...:||     .:::.
Human   269 LISNVCSIGDHVAQELFQGSDLGMAEEAERPGEKAGQHSPLREEHVTCVQSILDEFLQTYGSLIP 333

  Fly   343 VSSGDEETTAADDGQTERRLSPDEN----QTLFTYPPTGTGGL-----------SITIKDFMCLS 392
            :|: ||.....:|...:...:|...    |.:.:|.......:           .:|:.|...|.
Human   334 LST-DEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTLY 397

  Fly   393 KGSYLNDIIIDFYLRWLKNNIIPEEQRDRTHIFSTFFHKRLTTRTNPRNTKQTAAQKRHERVEKW 457
            ..::|||.:::.|     .:::.:...::.|.|::||:.:|.|             |.::.|::|
Human   398 GQNWLNDQVMNMY-----GDLVMDTVPEKVHFFNSFFYDKLRT-------------KGYDGVKRW 444

  Fly   458 TRNVNIFDKDFIIIPFNEQSHWILAIICYPNLRSPVVNNNNVQTTLSDDIPIKQPLILIFDSLAV 522
            |:||:||:|:.::||.:.:.||.|.                       .:.:::..|..|||...
Human   445 TKNVDIFNKELLLIPIHLEVHWSLI-----------------------SVDVRRRTITYFDSQRT 486

  Fly   523 TSRHRAIAILRDYLTC-EHKAKYPNALAHVFNKDNMPGH-------SVEVPQQQNLTDCGLYLLQ 579
            .:|.           | :|.|||..|.|  ..||.:..|       .:.|.:|.|.:|||.::||
Human   487 LNRR-----------CPKHIAKYLQAEA--VKKDRLDFHQGWKGYFKMNVARQNNDSDCGAFVLQ 538

  Fly   580 Y 580
            |
Human   539 Y 539

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 21/101 (21%)
Peptidase_C48 396..585 CDD:304959 48/194 (25%)
SENP3NP_056485.2 Nuclear localization signal. {ECO:0000255} 125..128
Nuclear localization signal. {ECO:0000255} 153..159
Protease 386..543 51/209 (24%)
Peptidase_C48 400..572 CDD:280975 48/195 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.