DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and SENP6

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_056386.2 Gene:SENP6 HGNCID:20944 Length:1112 Species:Homo sapiens

Alignment Length:967 Identity:208/968 (21%)
Similarity:328/968 (34%) Gaps:370/968 (38%)


  Fly     1 MDRKETVSKDQAVRRIAHNDFILVSRQLLINR---------ADTDPD-KGSARMLIIYSSGKQHI 55
            :||||.......|:::..|. :.:||...:.|         :..:|: |...:.       |:|.
Human   155 LDRKERKEYPPHVQKVEINP-VRLSRLQGVERIMKKTEESESQVEPEIKRKVQQ-------KRHC 211

  Fly    56 VTFK-LPNLACRVQDLFFQM-DLQIDESTTIDCIENAGGIIHLVV--SVGFPISDNIAETVAHAE 116
            .|:: .|.|:...:.....: |||.:....|...|:.|.::...:  :.|...|.|...|   .:
Human   212 STYQPTPPLSPASKKCLTHLEDLQRNCRQAITLNESTGPLLRTSIHQNSGGQKSQNTGLT---TK 273

  Fly   117 EFYRKVHQSKASSADAAPPNAMAGEEHSPAVVKPSETAVANNG--CQPAASATK--GKKHKKSPC 177
            :||       .::.:..|.:.:...:.|      ..|.:..||  ..|.|...|  ..|.:|:  
Human   274 KFY-------GNNVEKVPIDIIVNCDDS------KHTYLQTNGKVILPGAKIPKITNLKERKT-- 323

  Fly   178 GSPGENNDGQVILSADQDANTNTKAKK-------QKKCHIAKDNNGIQAASSHDN---------- 225
             |..:.||..::.|.|.|.|..|..::       ...|.....:.|...|:.::|          
Human   324 -SLSDLNDPIILSSDDDDDNDRTNRRESISPQPADSACSSPAPSTGKVEAALNENTCRAERELRS 387

  Fly   226 -PSSS-----------------GNK------------------------QGSHNSTAITSNSTMT 248
             |..|                 ||.                        |.|.:|..:...|...
Human   388 IPEDSELNTVTLPRKARMKDQFGNSIINTPLKRRKVFSQEPPDALALSCQSSFDSVILNCRSIRV 452

  Fly   249 SNGLRGV----------------QPAEDAPAI---------SQWIQSRN---------NAAVSKK 279
            ....|.:                :|..|...|         .:|...|.         .|...|.
Human   453 GTLFRLLIEPVIFCLDFIKIQLDEPDHDPVEIILNTSDLTKCEWCNVRKLPVVFLQAIPAVYQKL 517

  Fly   280 SEETAGGSQSRVQSNVASISSPAVKATS----------DAAIPTPAERAERS-----RLRRNRNW 329
            |.:.....:.:|.::...::    |.|:          ...:..||.....|     .::.|.:.
Human   518 SIQLQMNKEDKVWNDCKGVN----KLTNLEEQYIILIFQNGLDPPANMVFESIINEIGIKNNISN 578

  Fly   330 ILSRDVDEDA---VVLVSSGDEETTAADDGQTERRL------------------------SPDEN 367
            ..::...|:|   :|..:...||:.....||.|.::                        ...||
Human   579 FFAKIPFEEANGRLVACTRTYEESIKGSCGQKENKIKTVSFESKIQLRSKQEFQFFDEEEETGEN 643

  Fly   368 QTLF--------TY-PPTGTGGLSITIKDFMCLSKGSYLNDIIIDFYLRWLKNNIIPEEQRDRTH 423
            .|:|        .| ||...||:|:|.:|..||::|.:|||:||||||::|....:.:|..||.|
Human   644 HTIFIGPVEKLIVYPPPPAKGGISVTNEDLHCLNEGEFLNDVIIDFYLKYLVLEKLKKEDADRIH 708

  Fly   424 IFSTFFHKRLT--TRTNPRNTKQTAAQKRHERVEKWTRNVNIFDKDFIIIPFNEQSHWILAIICY 486
            |||:||:|||.  .|.|...|..:..||||.||:.|||:|:||:||||.:|.||.:||.||::|:
Human   709 IFSSFFYKRLNQRERRNHETTNLSIQQKRHGRVKTWTRHVDIFEKDFIFVPLNEAAHWFLAVVCF 773

  Fly   487 PNLRSP--------------------------------------------------------VVN 495
            |.|..|                                                        |::
Human   774 PGLEKPKYEPNPHYHENAVIQKCSTVEDSCISSSASEMESCSQNSSAKPVIKKMLNKKHCIAVID 838

  Fly   496 NN--------------------------------------------------------------- 497
            :|                                                               
Human   839 SNPGQEESDPRYKRNICSVKYSVKKINHTASENEEFNKGESTSQKVADRTKSENGLQNESLSSTH 903

  Fly   498 ------NVQTTLSDDIP-----------------------------------------------I 509
                  .::...||:.|                                               .
Human   904 HTDGLSKIRLNYSDESPEAGKMLEDELVDFSEDQDNQDDSSDDGFLADDNCSSEIGQWHLKPTIC 968

  Fly   510 KQPLILIFDSLAVTSRHRAIAILRDYLTCEHKAKYPNALAHVFNKDNMPGHSVEVPQQQNLTDCG 574
            |||.||:.|||...||...:.|||:||..|.:.|  ......|:||.|.|.:.:||||.|.:|||
Human   969 KQPCILLMDSLRGPSRSNVVKILREYLEVEWEVK--KGSKRSFSKDVMKGSNPKVPQQNNFSDCG 1031

  Fly   575 LYLLQYVEQFFTKPINDYTLPIKELSNWFDLLTVTKKREDIANLIKKLMNESNQQRK 631
            :|:|||||.||..||..:.||: .|:|||....:..|||:|.|:|.||..:.:::::
Human  1032 VYVLQYVESFFENPILSFELPM-NLANWFPPPRMRTKREEIRNIILKLQEDQSKEKR 1087

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 44/304 (14%)
Peptidase_C48 396..585 CDD:304959 94/363 (26%)
SENP6NP_056386.2 Protease 666..1112 117/426 (27%)
Peptidase_C48 680..>825 CDD:304959 52/145 (36%)
Peptidase_C48 <973..1049 CDD:304959 37/78 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107338981
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000927
OrthoInspector 1 1.000 T610033
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46896
Phylome 1 0.910 0.889 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1602
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.