DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and ulp2

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_593475.2 Gene:ulp2 PomBaseID:SPAC17A5.07c Length:638 Species:Schizosaccharomyces pombe

Alignment Length:487 Identity:134/488 (27%)
Similarity:210/488 (43%) Gaps:91/488 (19%)


  Fly   209 HIAKDNNGIQAASSHDNPSSSGNKQGSHNSTAITSNSTMTSNGLRGVQPAEDAPAISQWIQSRNN 273
            |:.....|:......|...:|.:.............||        :.|......:...::..::
pombe   195 HVESARAGLDLLDQSDFSLTSPSSAKEFKQLLTLKQST--------IIPRTPQKTVRSIVKQTSS 251

  Fly   274 AAVSKKSEETAGGSQSRVQSNVASISSPAVKATSDAAIPTPAERAERSRLRRNRNWILSRDVDED 338
            ...||..:.:...|.:...||........:|.::.::...|.  |......:|::...:.:...|
pombe   252 PHSSKMPKHSLPSSPTPFNSNSGDSLLSRIKNSNQSSSERPT--ANNGAQEQNQSSSSAGNTSND 314

  Fly   339 AVVLVSSGDEETTAADDGQTERRLSPDENQTLFTYPPTGTGGLSITIKDFMCLSKGSYLNDIIID 403
            ...|.|.|.::|..:|...|          |:..||.:||..::||..|...|::|.:|||.|:|
pombe   315 FSTLCSQGSDKTLLSDASCT----------TILVYPFSGTNSIAITNTDLTRLNEGEFLNDTIVD 369

  Fly   404 FYLRWL------KNNIIPEEQRDRTHIFSTFFHKRLTTRTNPRNTKQTAAQKRHERVEKWTRNVN 462
            ||||:|      :|   |....| ||||:|||:.|||::  .::.|:..    |..|.|||:.|:
pombe   370 FYLRYLYCKLQTQN---PSLAND-THIFNTFFYNRLTSK--DKDGKRLG----HRGVRKWTQKVD 424

  Fly   463 IFDKDFIIIPFNEQSHWILAIICYPNLRSPV--------------VNNNNVQTTLSDDIPIKQPL 513
            :|.|.:||:|.||..||.|||||..:...||              |...:...|...::....|.
pombe   425 LFHKKYIIVPINETFHWYLAIICNIDRLMPVDTKLEEQDEIVMSSVEQPSASKTRQAELTSNSPA 489

  Fly   514 ILIFDSLAVTSRHR-AIAILRDYLTCEHKAKYPNALAHVFNKDN-------MPGHSVEVPQQQNL 570
            ||||||||  :.|: |:..||:||           |...|.:.|       :.|...:||||.|.
pombe   490 ILIFDSLA--NLHKGALNYLREYL-----------LEEAFERKNVHLKSTDIRGFHAKVPQQSNF 541

  Fly   571 TDCGLYLLQYVEQFFTKPIN------DYTLPIKELSNW---FDLLTVTKKREDIANLIKKLMNE- 625
            :|||:|.|.:||.|...|..      |.:|...:..|:   ::|..:...|.|:..||::|..| 
pombe   542 SDCGIYALHFVELFLETPEQVIANTLDKSLRRTDAKNFDQQWNLQKINTMRCDLKGLIRRLSTEW 606

  Fly   626 -SNQQRKILPVIKFPTLNGQLVMDEEDSEEEN 656
             ||.:|:.|.       :|.  .||||.|.::
pombe   607 SSNNERQSLS-------SGS--NDEEDKENDD 629

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 15/110 (14%)
Peptidase_C48 396..585 CDD:304959 80/217 (37%)
ulp2NP_593475.2 ULP1 25..592 CDD:227489 118/440 (27%)
EB1_binding <230..312 CDD:283565 12/92 (13%)
Peptidase_C48 361..595 CDD:280975 87/257 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I1268
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000927
OrthoInspector 1 1.000 T631745
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.923 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1602
TreeFam 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.