DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and AF366264

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_694733.3 Gene:AF366264 MGIID:2667157 Length:502 Species:Mus musculus

Alignment Length:510 Identity:110/511 (22%)
Similarity:178/511 (35%) Gaps:164/511 (32%)


  Fly   124 QSKASSADAAPPNAMAGEEHSPAVVK--PSETAVANNGCQPAASATKGKKHKKSPCG-------S 179
            :.:.|......|.....::..|..:.  |.|.||  .|.:||..   ||.||: |..       |
Mouse    74 REQPSKGQVRKPQGKTPKQLKPLELTEGPPEQAV--TGRKPADG---GKGHKR-PYSVMEENEQS 132

  Fly   180 PGENNDGQVI--LSADQDAN----------TNT-KAKKQKKCHIAKDNNGIQAASSHDNPSS--- 228
            |.:...|:::  |..|||..          ||| |.|..:    :.|::|.:...|:..||:   
Mouse   133 PQKEKYGRLLQHLQCDQDVRSDQHRPHPILTNTWKIKGGE----SGDSHGSERIQSNREPSTVAA 193

  Fly   229 -------SGNKQGSHNSTAIT-SNSTMTSNGLRGVQPAEDAPAISQWIQ-----SRNNA------ 274
                   .|.::.......:| ....:...|.||.....|.|  ..|.|     .|.|:      
Mouse   194 LKECLSPEGREKCCSEEKCVTEKKGCVKGEGRRGNSLEPDLP--ETWAQIILDSGRGNSLLPNKV 256

  Fly   275 ---AVSKKSEETAGGSQSRVQSNVASISSPAVKATSDAAIPTPAERAERSRLRRNRNWILSRDVD 336
               |..||.....|  :.|....:..||....|...:|..|.|.|....||.:            
Mouse   257 AVLAAEKKPITDQG--KGRKMDQILDISEDMEKEIENALGPGPQEEILSSRFK------------ 307

  Fly   337 EDAVVLVSSGDEETTAADDGQTERRLSPDENQTLFTYPPTGTGGLSITIKDFMCLSKGSYLNDII 401
                :.:|.||.:|                                        |..|.:|||.:
Mouse   308 ----LQISRGDIQT----------------------------------------LENGQWLNDEV 328

  Fly   402 IDFYLRWLKNNIIPEEQRDR----THIFSTFFHKRLTTRTNPRNTKQTAAQKRHERVEKWTRNVN 462
            |:||:     |::.|...::    .|:|||||:.:|             ....:..|::|||.:|
Mouse   329 INFYM-----NLLVERNENQGYPALHVFSTFFYPKL-------------KHSGYSSVKRWTRGIN 375

  Fly   463 IFDKDFIIIPFNEQSHWILAIICYPNLRSPVVNNNNVQTTLSDDIPIKQPLILIFDSLAVTSRHR 527
            :|:|:.|::|.:::.||.|.:                       |.:::..|:..||:..|.:..
Mouse   376 LFEKELILVPIHQRVHWSLVV-----------------------IDLRKRSIVYLDSMGQTGKSI 417

  Fly   528 AIAILRDYLTCEHKAKYPNALAHVFNKDNMPGHSVEVPQQQNLTDCGLYLLQYVE 582
            ...|.: ||..|.|.: .|..............|.|:|.|.|.:|||::..:|.:
Mouse   418 CETIFQ-YLQNESKTR-RNIELDPLEWKQCSVTSEEIPLQLNGSDCGVFTCKYAD 470

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 55/242 (23%)
Peptidase_C48 396..585 CDD:304959 47/192 (24%)
AF366264NP_694733.3 Peptidase_C48 <279..497 CDD:304959 62/292 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.