DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and Senp1

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_006520943.1 Gene:Senp1 MGIID:2445054 Length:698 Species:Mus musculus

Alignment Length:482 Identity:100/483 (21%)
Similarity:178/483 (37%) Gaps:172/483 (36%)


  Fly   212 KDN---NGIQAASSH---DNPSSSGN-------KQGSHNSTAITSNSTMTSNGLRGVQPAEDAPA 263
            ||:   || .:.:||   .:.||||:       :|.||::.:::|.:...:.|.:...|.....|
Mouse   263 KDSLLRNG-NSCASHVIGSDTSSSGSASILTAQEQLSHSAHSLSSGTPDVAFGSKDSDPHHHLAA 326

  Fly   264 ISQWIQSRNNAAVSKKSEETAGGSQSRVQSNVASISSPAVK-----------------ATSDAAI 311
            ..|    .|:...|....|   ||.|.:...|....:||.:                 |..|...
Mouse   327 PHQ----PNSLPASNTQSE---GSDSVILLKVKESQTPASRYLSPLKRRSCPYIIPYSAVMDLLS 384

  Fly   312 PTPA---------------ERAERSRLRRNRNWILSRDVDEDAVVLVSSGDEE------------ 349
            .:|.               :...|.||||         ::|...:.:...::.            
Mouse   385 SSPTFFQAELWIKELTSVYDSRARERLRR---------IEEQKALALQLQNQRLQEQEHAVLDSV 440

  Fly   350 --------------TTAADDGQTERRLSPDENQTLFTYPP----------------------TGT 378
                          |.|.:..:...:|:..|::    :|.                      :..
Mouse   441 ELHLRVPLEKEIPVTAAQETRKKSHQLTDSEDE----FPEITEEMEKEIKNVFRNGNQDEVLSEA 501

  Fly   379 GGLSITIKDFMCLSKGSYLNDIIIDFYLRWLKNNIIPEEQRDR----THIFSTFFHKRLTTRTNP 439
            ..|:||.||...|:..::|||.||:||:     |::.|..:::    .|.|:|||..:|.|    
Mouse   502 FRLTITRKDIQTLNHLNWLNDEIINFYM-----NMLMERSKEKGFPSVHAFNTFFFTKLKT---- 557

  Fly   440 RNTKQTAAQKRHERVEKWTRNVNIFDKDFIIIPFNEQSHWILAIICYPNLRSPVVNNNNVQTTLS 504
                     ..::.|::||:.|::|..|.:::|.:...||.||::.:                  
Mouse   558 ---------AGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDF------------------ 595

  Fly   505 DDIPIKQPLILIFDSLAVTSRHRAIAILRDYLTCE----HKAKYPNALAHVFNKDNMPGHSVEVP 565
                 ::..|..:||:...: :.|..||..||..|    .:.::......:|:|     .|.|:|
Mouse   596 -----RRKSITYYDSMGGIN-NEACRILLQYLKQESVDKKRKEFDTNGWQLFSK-----KSQEIP 649

  Fly   566 QQQNLTDCGLYLLQYVEQFFTK--PIN 590
            ||.|.:|||::..:|.: ..||  |||
Mouse   650 QQMNGSDCGMFACKYAD-CITKDRPIN 675

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 30/152 (20%)
Peptidase_C48 396..585 CDD:304959 48/197 (24%)
Senp1XP_006520943.1 Peptidase_C48 <474..696 CDD:304959 60/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.