DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and Senp6

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001298039.1 Gene:Senp6 MGIID:1922075 Length:1139 Species:Mus musculus

Alignment Length:630 Identity:164/631 (26%)
Similarity:241/631 (38%) Gaps:232/631 (37%)


  Fly   187 QVILSADQDANTNTKAKKQKKCHIAKDNNGIQAASSHDNPSSSGNKQ--------GSHNSTAITS 243
            |.|.:..|..:...:..|:.|  :..|..||       |..:|..:|        |..:...:..
Mouse   535 QAIPAVYQKLSMQLQMSKEDK--VWNDCKGI-------NRITSLEEQYIILIFQTGLDHQAEVVF 590

  Fly   244 NSTMTSNGLRGVQPAEDAPAISQWIQSRNNAAVSKKSEETAGGSQSRVQSNVASISSPAVKATSD 308
            .|.:|..|:|...|...|..:.....|| ..|.::..||:..|:.::.::.|.::|.        
Mouse   591 ESIITDIGIRNNVPNFFAKILFDEANSR-LVACTRSYEESIKGNCAQKENKVKTVSF-------- 646

  Fly   309 AAIPTPAERAERSRLR-RNRNWILSRDVDEDAVVLVSSGDEETTAADDGQTERRLSPDENQTLFT 372
                       .|::: |::..:...|.||:|      |:..|..         :.|.|.  |..
Mouse   647 -----------ESKIQLRSKQELQFFDDDEEA------GESHTIF---------IGPVEK--LIV 683

  Fly   373 Y-PPTGTGGLSITIKDFMCLSKGSYLNDIIIDFYLRWLKNNIIPEEQRDRTHIFSTFFHKRLT-- 434
            | ||...||:|:|.:|..|||:|.:|||:||||||::|....:.:|..||.||||:||:|||.  
Mouse   684 YPPPPAKGGISVTNEDLHCLSEGEFLNDVIIDFYLKYLVLEKLKKEDADRIHIFSSFFYKRLNQR 748

  Fly   435 TRTNPRNTKQTAAQKRHERVEKWTRNVNIFDKDFIIIPFNEQSHWILAIICYPNLRSP------- 492
            .|.||..|..:..||||.||:.|||:|:||:||||.:|.||.:||.||::|:|.|..|       
Mouse   749 ERRNPETTNLSIQQKRHGRVKTWTRHVDIFEKDFIFVPLNEAAHWFLAVVCFPGLEKPKYEPNPH 813

  Fly   493 ----------------------------------------------------------------- 492
                                                                             
Mouse   814 YHENAVMQKTPSAEDSCVSSASEMGACSQNSAAKPVIKKMLNRKHCLAVTDSSAAQEESEPCYRR 878

  Fly   493 --------------VVNNN----NVQTTLSD---------------------------------- 505
                          .:|.|    |.::|..|                                  
Mouse   879 NAYSVKCSMKKKNHAINENEEPSNGESTCQDICDRTQSENGLRDECFSSVHHPDALSKIRLNYGD 943

  Fly   506 --------------------DIP---------------------------IKQPLILIFDSLAVT 523
                                |.|                           .|||.||:.|||...
Mouse   944 QSADGGKLLEDELIDFSEDQDDPDDSSDDGLLADENYSSEIGQWHLKPTVCKQPCILLMDSLRGP 1008

  Fly   524 SRHRAIAILRDYLTCEHKAKYPNALAHVFNKDNMPGHSVEVPQQQNLTDCGLYLLQYVEQFFTKP 588
            ||...:.|||:||..|.:.|  ......|:||.|.|.:.:||||.|.:|||:|:|||||.||..|
Mouse  1009 SRSNVVKILREYLEVEWEVK--KGSKRSFSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENP 1071

  Fly   589 INDYTLPIKELSNWFDLLTVTKKREDIANLIKKLMNESNQQRKIL 633
            :.::.||: .|.|||....:..|||:|.|:|.||....::.:|:|
Mouse  1072 VLNFELPM-NLMNWFPPPRMKTKREEIRNIILKLQESQSKDKKLL 1115

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 26/140 (19%)
Peptidase_C48 396..585 CDD:304959 97/362 (27%)
Senp6NP_001298039.1 Protease 693..1139 122/427 (29%)
Peptidase_C48 707..>819 CDD:304959 53/112 (47%)
Peptidase_C48 <999..1075 CDD:304959 36/78 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107338943
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000927
OrthoInspector 1 1.000 T616841
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46896
Phylome 1 0.910 0.889 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1602
TreeFam 1 0.960
87.830

Return to query results.
Submit another query.