DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and SENP5

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_689912.2 Gene:SENP5 HGNCID:28407 Length:755 Species:Homo sapiens

Alignment Length:512 Identity:110/513 (21%)
Similarity:184/513 (36%) Gaps:163/513 (32%)


  Fly   144 SPAVVKPSETAVANNGCQPAASATKGKKHKKSPCGSPGENNDGQVILS-----ADQDANTNTKAK 203
            |.||||.:.:.|.:  |....|:..||:                  ||     .||...:.|.|.
Human   312 SSAVVKGTNSHVPD--CHTKGSSFLGKE------------------LSLDEAFPDQQNGSATNAW 356

  Fly   204 KQKKCHIAKDNNGIQAASS---------HDNPSSSGNKQ--------------GSHNSTAITSNS 245
            .|..|            ||         ||.|.......              |..|.|:..|:.
Human   357 DQSSC------------SSPKWECTELIHDIPLPEHRSNTMFISETEREIMTLGQENQTSSVSDD 409

  Fly   246 --TMTSNGLRGVQPAEDAPAISQWIQSRNNAAVSKKSEETAGGSQSRVQSNVASISSPAVKATSD 308
              .::.:|......:.|.|...:.:|:.|    |.:.||.....||.:.|.:  :..|..|:..:
Human   410 RVKLSVSGADTSVSSVDGPVSQKAVQNEN----SYQMEEDGSLKQSILSSEL--LDHPYCKSPLE 468

  Fly   309 AAIPTPAERAERSRLRRNRNWILSRDVDEDAVVLVSSG--DE------ETTAADDGQTERRLSPD 365
            |.:.....:.| :::...:|...:..||::.:.:..||  ||      ......:.:...||...
Human   469 APLVCSGLKLE-NQVGGGKNSQKASPVDDEQLSVCLSGFLDEVMKKYGSLVPLSEKEVLGRLKDV 532

  Fly   366 ENQTLFTYPPTGTGGLS-------------------ITIKDFMCLSKGSYLNDIIIDFYLRWLKN 411
            .|:......|.....::                   :.:.|...|...::|||.:|:.|     .
Human   533 FNEDFSNRKPFINREITNYRARHQKCNFRIFYNKHMLDMDDLATLDGQNWLNDQVINMY-----G 592

  Fly   412 NIIPEEQRDRTHIFSTFFHKRLTTRTNPRNTKQTAAQKRHERVEKWTRNVNIFDKDFIIIPFNEQ 476
            .:|.:...|:.|.|::|||::|.|             |.:..|::||:.|::|.|..::||.:.:
Human   593 ELIMDAVPDKVHFFNSFFHRQLVT-------------KGYNGVKRWTKKVDLFKKSLLLIPIHLE 644

  Fly   477 SHWILAIICYPNLRSPVVNNNNVQTTLSDDIPIKQPLILIFDSLAVTSRHRAIAILRDYLTCEHK 541
            .||.|                 :..|||:.|      |..:||..:..:. .:..:|.||..|.:
Human   645 VHWSL-----------------ITVTLSNRI------ISFYDSQGIHFKF-CVENIRKYLLTEAR 685

  Fly   542 AKYPNALAHVFNKDNMP----GHSVEV----PQQQNLTDCGLYLLQY-----VEQFF 585
            .|            |.|    |....|    |||:|.:|||:::|||     :||.|
Human   686 EK------------NRPEFLQGWQTAVTKCIPQQKNDSDCGVFVLQYCKCLALEQPF 730

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 41/205 (20%)
Peptidase_C48 396..585 CDD:304959 54/202 (27%)
SENP5NP_689912.2 Protease 567..724 54/211 (26%)
Peptidase_C48 581..753 CDD:280975 55/205 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.