DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and ulp-1

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_498095.3 Gene:ulp-1 WormBaseID:WBGene00006736 Length:697 Species:Caenorhabditis elegans

Alignment Length:535 Identity:117/536 (22%)
Similarity:199/536 (37%) Gaps:150/536 (28%)


  Fly    99 SVGFPISDNIAE----TVAHAEEFYRKVHQSKASSADAAPPNAMAGEEHSPAVVKPS-------- 151
            ||..||:.:::.    |..:..:::|:....|.......|.....  :||.:|.|.:        
 Worm   227 SVSRPITPSLSSLSNYTSNNVRDYWRRNSAKKPEVLRRVPVRHQF--KHSTSVRKMNTIIDLKKI 289

  Fly   152 -----------ETAVANNGCQPAASATKG---KKHKKSPCGSPGENNDGQVILSADQD------- 195
                       :..||:.  |..|.|..|   ||.||.      :......||:..::       
 Worm   290 KNHLSSRDRLLQGVVASG--QYEAKAISGIVEKKPKKM------QRTSSTDILARAKNKIAELGG 346

  Fly   196 ANTNTKAKKQKKCHIAKDNNGIQAASSHDNPSSSGNKQGSH---NSTAITSNSTMTSNGLRGVQP 257
            :.:||.:...::..|..|:....::|...:..|:.::..|:   |......||....:..||.| 
 Worm   347 SRSNTPSLLSREPSIIIDSEESTSSSYRQHARSNSSESDSYRKLNDILSQINSLGIGSAYRGPQ- 410

  Fly   258 AEDAPAISQWIQSRNNAAVSKKSEETAGGSQSRVQSNVASISSPAVKATSDAAI------PTPAE 316
                       :.:|:..:||:.|:                     |...:|.|      .|..:
 Worm   411 -----------RYQNSYQLSKQKED---------------------KLLEEARIREGHRSQTRGD 443

  Fly   317 RAERSRLRRNRNWILSRDVDEDAVVLVSSGDEETTAAD--DGQTERRLS---PDENQTLFTYPPT 376
            |.|..|.|.....|..|...|...|     |:.....|  |...||..|   |:| |.:..:   
 Worm   444 RLEDVRKRLELQGIAIRPKVEKKKV-----DDFMALPDAADALVERAWSGGNPNE-QFVDAF--- 499

  Fly   377 GTGGLSITIKDFMCLSKGSYLNDIIIDFYLRWLKNNIIPEEQRDRTHIFSTFFHKRLTTRTNPRN 441
               .:.|..||...||...:|||.||:|||:.:.:....:.:..:.:.|:|||:..:.:      
 Worm   500 ---SIQICKKDLATLSGLHWLNDEIINFYLQLICDRSNGDSKYPKIYAFNTFFYSNIVS------ 555

  Fly   442 TKQTAAQKRHERVEKWTRNVNIFDKDFIIIPFNEQSHWILAIICYPNLRSPVVNNNNVQTTLSDD 506
                   |.:..|::|||.|:||..|.:::|.:...||.:|:|                     |
 Worm   556 -------KGYASVKRWTRKVDIFAFDIVLVPVHLGMHWCMAVI---------------------D 592

  Fly   507 IPIKQPLILIFDSLAVTSRHRAIAILRDYLTCEHKAKYPNALAHVFNKDNMPGHSV----EVPQQ 567
            :..|:  |..:||| .......:..||.||..|...|...|:       |..|.::    ::|:|
 Worm   593 MGEKK--IEFYDSL-YDGNTAVLPALRGYLEAESLDKKKTAM-------NFSGWTIQQMTDIPRQ 647

  Fly   568 QNLTDCGLYLLQYVE 582
            ||.:|||::..|:.|
 Worm   648 QNGSDCGVFSCQFGE 662

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 40/235 (17%)
Peptidase_C48 396..585 CDD:304959 50/192 (26%)
ulp-1NP_498095.3 Peptidase_C48 <425..692 CDD:304959 76/295 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.