DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and ulp-4

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_495703.2 Gene:ulp-4 WormBaseID:WBGene00006739 Length:382 Species:Caenorhabditis elegans

Alignment Length:337 Identity:72/338 (21%)
Similarity:142/338 (42%) Gaps:78/338 (23%)


  Fly   335 VDEDAVVLVSSGDEETTAADDGQTERRLSPDENQTLF---------TYPPTGTGGLSITIKDFMC 390
            ||||.       :||....:|..|.::.:.::|...:         .:|   ...::|.|.||.|
 Worm    86 VDEDE-------EEEDEEDNDEWTNQKRTDNQNSVAYYAAMEMLRIRFP---FQSIAIRISDFCC 140

  Fly   391 LSKGSYLNDIIIDFYLRWLKNNIIPEEQRDRTHIFSTFFHKRLTTRTNPRNTKQTAAQKRHERVE 455
            |.:...|||.:|||||..:..:::|:.......:..:.|...|:.|.:..:::........::::
 Worm   141 LQEKDLLNDTMIDFYLNHIVEHVLPDSNGSNVTVLPSIFWHNLSLRQHAFDSEDEKMMSDEQKMD 205

  Fly   456 -------KWTRNVNIFDKDFIIIPFNEQSHWILAIICYPNLRSPVVNNNNVQTTLSDDIPIKQPL 513
                   .:..:.::.|.|:|::|.||..||.||:||:|.                    ..|..
 Worm   206 LKFGDLHDFVADFDLQDFDYIVVPVNEWEHWSLAVICHPF--------------------TAQAR 250

  Fly   514 ILIFDS---LAVTSRHRAIAILRDYLTCEHKAKYPNALAHVFNKDNMPGHSV---EVPQQQNLTD 572
            .:||||   ..:.:......::..::...::.:..||:.       .|...:   .:|||.|..|
 Worm   251 TVIFDSQLTADLNNLQNMATLIESFMKYSYEKRTGNAMP-------FPLPCILPQRMPQQTNNFD 308

  Fly   573 CGLYLLQYVEQFFTKPINDYTLPIKELSN------WFDLLTVTKKREDIANLIKKLMNESNQQRK 631
            ||:::.::..:|...|      | |:|.|      :.|..|.||:.|    :.:.:::.|..:.:
 Worm   309 CGIFIAEFARRFLLSP------P-KDLDNFDFAREYPDFSTATKRTE----MQRVVLSLSTNRAR 362

  Fly   632 ILPVIKFPTLNG 643
            ..|:::.  |||
 Worm   363 WRPLVEL--LNG 372

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191
Peptidase_C48 396..585 CDD:304959 41/202 (20%)
ulp-4NP_495703.2 Peptidase_C48 145..333 CDD:304959 46/222 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131145685
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6692
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000927
OrthoInspector 1 1.000 T375107
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1602
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.