DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and 4930444G20Rik

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_444494.1 Gene:4930444G20Rik MGIID:2149738 Length:495 Species:Mus musculus

Alignment Length:513 Identity:108/514 (21%)
Similarity:175/514 (34%) Gaps:171/514 (33%)


  Fly   123 HQSKASSADAAPPNAMAGEEHSPAVVKPSETAVANNGCQPAASATKGKKHKKSPCG-------SP 180
            |.||   .....|.....::..|..:..........|.:||..   ||.||: |..       ||
Mouse    69 HPSK---GQVRKPQGKTPKQLEPLELTEGSPEQVVTGRKPADG---GKGHKR-PYSVMEENEQSP 126

  Fly   181 GENNDGQVI--LSADQDAN----------TNT-KAKKQKKCHIAKDNNGIQAASSHDNPSS---- 228
            .:...|:::  |..|||.:          ||| |.|..:    ::|:.|.:...|...||:    
Mouse   127 QKEKYGRLLQHLQCDQDVSSDPHRPHPFLTNTWKIKGGE----SEDSRGSERTQSDREPSTVVAL 187

  Fly   229 -------SGNKQGSHNSTAITSNSTMTSNGLRGVQPAEDAPAISQWI---QSRNNA--------- 274
                   ...|..|...........:...|.||.....|.|.....|   ..:.|:         
Mouse   188 KECLSPEEREKCCSEEKCVTEKKDCIKGEGRRGNSLEPDLPGTQAQIILDSGKGNSLFPNKVAVL 252

  Fly   275 AVSKKSEETAGGSQSRVQSNVASISSPAVKATSDAAIPTPAERAERSRLRRNRNWILSRDVDEDA 339
            |..||.....|  :.|....:..|:....|...:|..|.|.|....||.:               
Mouse   253 AAEKKPITDRG--KGREMDQILDITEDMEKEIENALGPGPQEEILSSRFK--------------- 300

  Fly   340 VVLVSSGDEETTAADDGQTERRLSPDENQTLFTYPPTGTGGLSITIKDFMCLSKGSYLNDIIIDF 404
             :.:|.||.:|                                        |..|.:|||.:|:|
Mouse   301 -LQISRGDIQT----------------------------------------LENGQWLNDEVINF 324

  Fly   405 YLRWLKNNIIPEEQRDR----THIFSTFFHKRLTTRTNPRNTKQTAAQKRH---ERVEKWTRNVN 462
            |:     |::.|...::    .|:|||||:.:|                :|   ..|::|||.:|
Mouse   325 YM-----NLLVERNENQGYPALHVFSTFFYPKL----------------KHGGYSSVKRWTRGIN 368

  Fly   463 IFDKDFIIIPFNEQSHWILAIICYPNLRSPVVNNNNVQTTLSDDIPIKQPLILIFDSLAVTSRHR 527
            :|:|:.|::|.:::.||.|.:                       |.:::..|:..||:..|.:..
Mouse   369 LFEKELILVPIHQRVHWSLVV-----------------------IDLRKRSIVYLDSMGQTGKSI 410

  Fly   528 AIAILRDYLTCEHKAKYPNALAHVFNKDNMPGHSV---EVPQQQNLTDCGLYLLQYVE 582
            ...|.: ||..|.|.:....|..:..|.    :||   |:|.|.|.:|||::..:|.:
Mouse   411 CETIFQ-YLQNESKTRRNVELDPLEWKQ----YSVTSEEIPLQLNGSDCGMFTCKYAD 463

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 50/239 (21%)
Peptidase_C48 396..585 CDD:304959 50/198 (25%)
4930444G20RikNP_444494.1 Peptidase_C48 <272..490 CDD:304959 64/298 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.