DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and LOC103689978

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_008767001.1 Gene:LOC103689978 RGDID:9388747 Length:811 Species:Rattus norvegicus

Alignment Length:641 Identity:135/642 (21%)
Similarity:211/642 (33%) Gaps:252/642 (39%)


  Fly   160 CQPAASATKGKKHKKSPCG-SPGENNDGQVILSADQDANTNTKAKKQKKCHI---------AKD- 213
            |.|..|.     ..|.||. .|         ...|.|::...|.   |.||:         |.| 
  Rat   286 CSPVPSL-----EPKDPCRCQP---------YFPDMDSSAVVKG---KNCHVPDGHTKESPALDK 333

  Fly   214 NNGIQAA----------SSHDNPSSSGNKQ--------------GSHNSTAITSNSTMTSNGLRG 254
            .:|:.||          .:.|.||||...:              .|.|.|..|..:.||..    
  Rat   334 EHGLDAAFPDQQNGSTTYTWDQPSSSPKWECTEQIHEIPLMGHPSSDNFTPGTERALMTLG---- 394

  Fly   255 VQPAEDAPAISQWIQSRNNAAVSKKSEETAGGSQSRVQSNVASISSPAVKATSDAAIPTPAERAE 319
                          |....:||   |::....|.|....:|:|:..|   .:.:.|.....:..|
  Rat   395 --------------QESGTSAV---SDDGVKLSVSGADESVSSVDGP---VSEEPAQNENFQMEE 439

  Fly   320 RSRLRRNRNWILSRDVDE--------DAVVL---------VSSGDEETTAA--DDGQTERRLSPD 365
            ...||:|   |||..:.:        ||.::         |:.|....||:  ||.|....||..
  Rat   440 DGSLRQN---ILSSKLLDHPYCKSPLDAPLVCSELKVENQVAGGKSGQTASPVDDEQLSTCLSGF 501

  Fly   366 ENQTLFTYPPTGTGGL------------------------------------------------- 381
            .::.:..|     |.|                                                 
  Rat   502 LDEVMKKY-----GSLVPLSEKDVLGRLKDVFNEDFSNRKPFINREITNYRARHQKCNFRIFYNK 561

  Fly   382 -SITIKDFMCLSKGSYLNDIIIDFYLRWLKNNIIPEEQRDRTHIFSTFFHKRLTTRTNPRNTKQT 445
             .:.:.|...|...::|||.:|:.|     ..:|.:...|:.|.|::|||::|.|          
  Rat   562 HMLDMDDLATLDGQNWLNDQVINMY-----GELIMDAVPDKVHFFNSFFHRQLVT---------- 611

  Fly   446 AAQKRHERVEKWTRNVNIFDKDFIIIPFNEQSHWILAIICYPNLRSPVVNNNNVQTTLSDDIPIK 510
               |.:..|::||:.|::|.|..::||.:.:.||.|                 :..|||..|   
  Rat   612 ---KGYNGVKRWTKKVDLFKKSLLLIPIHLEVHWSL-----------------ITVTLSSRI--- 653

  Fly   511 QPLILIFDSLAVTSRHRAIAILRDYLTCEHKAKYPNALAHVFNKDNMP----GHSVEV----PQQ 567
               |..:||..:..:. .:..:|.||..|.:.|            |.|    |....|    |||
  Rat   654 ---ISFYDSQGIHFKF-CVENIRKYLLTEAREK------------NRPEFLQGWQTAVTKCIPQQ 702

  Fly   568 QNLTDCGLYLLQYVEQF--------FTKPINDYTLPIKE----LSNWFDLLTVTKKREDIANLI- 619
            :|.:|||:::||....|        |.:.|......::|    |..|..|::|      .|::| 
  Rat   703 KNDSDCGVFVLQVNTTFRVCELVGLFREMIVACAYSVREDNTFLCCWDILVSV------FAHVII 761

  Fly   620 -KKLMNESNQQRKILPVIKFPTLNGQLVMDEEDSEEENSKEEH----KTTLVCSKD 670
             |..:..:.:.|.     .:|.|.|        |..:..:|.|    |.||..|.:
  Rat   762 RKNCLLGTRRDRG-----SYPCLTG--------SYSKYIREVHVFMGKVTLHMSSE 804

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 39/194 (20%)
Peptidase_C48 396..585 CDD:304959 52/205 (25%)
LOC103689978XP_008767001.1 Peptidase_C48 576..714 CDD:304959 50/192 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.