DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and senp7

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_012813075.2 Gene:senp7 XenbaseID:XB-GENE-1000860 Length:875 Species:Xenopus tropicalis

Alignment Length:807 Identity:194/808 (24%)
Similarity:301/808 (37%) Gaps:235/808 (29%)


  Fly     4 KETVSKDQAVRRIAH---------NDFILVSRQLLINRADTDPD---KGSARMLIIYSSGKQ--- 53
            :||:.:.:|.|.:::         |.......|:....:..:|:   |....|:...|..|:   
 Frog   124 QETIQQSKACRDVSNTSNSSLKETNSRRSYYEQVTSGSSQKEPEQETKSPVNMISSPSKSKRDRT 188

  Fly    54 ---------HIVTFKLP---NLACRVQDLFFQMDLQIDESTTIDCIENAGGIIHLVVSVGFPISD 106
                     |..:..||   ::......|...:.|..|.       .|.|.:..|..:.|..::.
 Frog   189 YCQKLAEQMHNKSSLLPEQDSVCVNASPLEENLHLSTDS-------PNIGSVSTLKSNSGTTLTG 246

  Fly   107 NIA-------ETVAHAEEFYR--KVHQSKASSADAAPPNAMAGEEHSPAVVKPSETAVANNGCQP 162
            :|:       .|..:.:.|.|  |.|.|..::..::.|..::.:|...:..:.:| :|.......
 Frog   247 DISGSPNLVKHTSNNVQLFKRNVKTHISNKATPSSSEPIVLSSDEEERSHGETAE-SVMEKPLTE 310

  Fly   163 AASATKGKKHKKSPCGSPGENNDGQVILSAD-----------QDANTNTKAKKQKKC-------- 208
            .....:|.:|.:..|....:......:||.:           :..:...:...||.|        
 Frog   311 MIDMNEGTEHNQLSCNETSKLMVCNCLLSHNISFFSLLKFTAKSIDIPLRVTLQKNCTVSFSTAV 375

  Fly   209 ----------------------HIAKDNN-GIQAASSHDNPSSSGNKQGSHNSTAITSNSTMTSN 250
                                  .::.||: .:|..:|..||.|                      
 Frog   376 LCKYGVWETDKDFVRSRAIIFLWVSSDNDIEMQLGTSIKNPVS---------------------- 418

  Fly   251 GLRGVQPAEDAPAISQWIQSRNNAAVSKKSEETAGGSQSRVQSNVASISSPAVKATSD------- 308
                 :|.|       :|....|..:|||.::..    :::.:..:...||.:|....       
 Frog   419 -----KPVE-------FIFLELNVMLSKKEQDVL----NKIMNEASKKGSPGLKDIMSWQMACPL 467

  Fly   309 ---------------------------AAIPTPAERAERSRLRR--NRNWILSRDVDEDAVVLVS 344
                                       .|:..|...:|.|..::  |...:|.|....    |.|
 Frog   468 FKDLPLAENAFMSNCLPAFQKQQPHPPEALTLPEHSSECSSPKQAPNTYTLLQRQTGR----LYS 528

  Fly   345 SGDEETTAADDGQTERRLSPDENQTLFTYPPTGT-GGLSITIKDFMCLSKGSYLNDIIIDFYLRW 408
            :  ......|:|.||.| .......|..|||..| |||.:|.:|..||..|.:|||:||||||::
 Frog   529 A--SLVPKQDNGWTEMR-HAGSLLKLIVYPPPPTKGGLCVTNEDLDCLEHGEFLNDVIIDFYLKY 590

  Fly   409 LKNNIIPEEQRDRTHIFSTFFHKRLTTR---TNPRNTKQTAAQKRHERVEKWTRNVNIFDKDFII 470
            |.....|:...:|:||||:||:|.||.:   .|.......|||:||:||:.|||:|:||.||||.
 Frog   591 LLLERFPKHFAERSHIFSSFFYKCLTRKEIAANESCASLPAAQRRHQRVKTWTRHVDIFTKDFIF 655

  Fly   471 IPFNEQSHWILAIICYPNLRSPVVNNNNVQTT--------------------------------- 502
            :|.||.|||.||:||:|.|.|......|..:|                                 
 Frog   656 VPVNENSHWYLAVICFPWLESAEFEERNFDSTNLCGKPPKEASNTTCSVIVFNDHLEKEEETIVD 720

  Fly   503 --LSDDIP------------------------IKQPLILIFDSLAVTSRHRAIAILRDYLTCEHK 541
              .|||..                        .|:|.:||||||...|....:.:||:||..|.:
 Frog   721 DSSSDDSTRPSPHSGSNKKKSRETKGNLCRKVCKRPCLLIFDSLKSGSVQTTVQVLREYLKVEWE 785

  Fly   542 AKYPNALAHVFNKDNMPGHSVEVPQQQNLTDCGLYLLQYVEQFFTKPINDYTLPIKELSNWFDLL 606
            .|  ......|::.||.....:||:|.|.|||||:||||||.|..:||.::..|| .|.:||.|.
 Frog   786 VK--RKTMREFSRSNMRDFYPKVPKQNNSTDCGLFLLQYVESFVQQPIENFDSPI-HLEDWFPLT 847

  Fly   607 TVTKKREDIANLIKK--LMNESNQQRK 631
            .|..|||:|.:||.|  |..:.|...|
 Frog   848 VVKSKREEIRDLILKLHLQQDGNSGNK 874

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 33/273 (12%)
Peptidase_C48 396..585 CDD:304959 91/251 (36%)
senp7XP_012813075.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000927
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.