DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and senp1

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_002933743.1 Gene:senp1 XenbaseID:XB-GENE-1014921 Length:621 Species:Xenopus tropicalis

Alignment Length:572 Identity:128/573 (22%)
Similarity:216/573 (38%) Gaps:180/573 (31%)


  Fly   118 FYRKVHQSKASSADAAPP----NAMAGEEHSPAVVKPSETAVA---------NNGCQPAASATKG 169
            |::|....::|..:|..|    ||::        |||:.|..:         |..|..:.:....
 Frog   100 FFQKPRVPRSSHMEARKPSGALNAVS--------VKPNHTVTSAYEKSFPFKNISCSASLAGPCR 156

  Fly   170 KKHKKSPCGSPGENNDG-------------QVILSADQDANTNTKAKKQKKCHIAKDNN--GIQA 219
            :..||.....|....:.             ||:......|..:|.....:...::.||:  |...
 Frog   157 RSPKKIQRRLPSTVEETVREEEKEIYRQLLQVVTGKSFLATKSTSVLPPQVSRLSSDNSICGQPI 221

  Fly   220 ASSHDN--PSSSGNKQGSHNSTAITSNSTMTSNGLRGVQPAEDAPAISQWIQSRNNAAVSKKSEE 282
            |||..:  |||...:     |:..||.|.:..:|    |.:|  |.:|       |:...|.:.:
 Frog   222 ASSLSSLEPSSLDTE-----SSCRTSFSYLQPSG----QISE--PLLS-------NSTNYKVTSD 268

  Fly   283 TAGGSQSRVQ-------------SNVASISSPAVKATSDAAIPT--PAERAE----------RSR 322
            |.|.|..::.             |:...:..|.||......:||  |...||          .||
 Frog   269 TQGASNQQLPKEKFVPTSQQSQGSDSVIVLDPVVKPQVPGQVPTSQPFFHAELWIKELTSLFDSR 333

  Fly   323 LRRNRNWI-------------------LSRDVD---------EDAVVLVSSGDEETTAADDGQ-- 357
            .|..|..|                   :...:|         |..|.|:...::|:|.:::.:  
 Frog   334 ARERRRQIEEQKAVALKLQKQRLQECSVQDSIDLHLRVPLEKEIPVTLIQKQEDESTQSEEIEFP 398

  Fly   358 -----TERRL-----SPDENQTLFTYPPTGTGG--LSITIKDFMCLSKGSYLNDIIIDFYLRWLK 410
                 .||.:     ...::|||       :.|  |:||.||.|.|...::|||.||:||:    
 Frog   399 ELTEAMEREIKRALFGGSQDQTL-------SEGYRLTITRKDIMTLHSLNWLNDEIINFYM---- 452

  Fly   411 NNIIPEEQR----DRTHIFSTFFHKRLTTRTNPRNTKQTAAQKRHERVEKWTRNVNIFDKDFIII 471
             |:|.|..:    .:.|.|:|||..:|.:             ..::.|::||:.|:||..:.:::
 Frog   453 -NLIMERSKRKGLPKVHAFNTFFFTKLKS-------------AGYQAVKRWTKKVDIFSMNILLV 503

  Fly   472 PFNEQSHWILAIICYPNLRSPVVNNNNVQTTLSDDIPIKQPLILIFDSLAVTSRHRAIAILRDYL 536
            |.:...||.||::.:                       ::..||.|||:...: :.|..||..||
 Frog   504 PIHLGVHWCLAVVDF-----------------------RKKSILYFDSMGGLN-NEACKILLQYL 544

  Fly   537 TCEHKAKYPNALAHVFNKDNMPGH-SVEVPQQQNLTDCGLYLLQYVEQFFTK 587
            ..|...|  ..::...|...:... |.|:|||.|.:|||::..:|.: :.||
 Frog   545 KQESIDK--KGVSFDSNGWTLTSKTSEEIPQQMNGSDCGMFACKYAD-YITK 593

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 49/242 (20%)
Peptidase_C48 396..585 CDD:304959 50/194 (26%)
senp1XP_002933743.1 Peptidase_C48 <355..619 CDD:304959 71/292 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.