| Sequence 1: | NP_001285167.1 | Gene: | CG12717 / 32229 | FlyBaseID: | FBgn0030420 | Length: | 681 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_001343517.1 | Gene: | senp1 / 100007636 | ZFINID: | ZDB-GENE-030131-6462 | Length: | 729 | Species: | Danio rerio | 
| Alignment Length: | 676 | Identity: | 132/676 - (19%) | 
|---|---|---|---|
| Similarity: | 228/676 - (33%) | Gaps: | 257/676 - (38%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    57 TFKLPNLACRVQDLFFQMDLQIDESTTID-------CIEN-------AGGIIHLVVSVGFPISDN 107 
  Fly   108 IAETVAHAEEFYRKVHQSKASSADAAPPNAMAGEE--HSP-AVVKPSETAVANNGCQPAASATKG 169 
  Fly   170 KKHKKS------PCGSPGENNDGQVILSADQDANTNTKAKKQKKCH---IAKDNNGIQAASSHDN 225 
  Fly   226 PSSSGNKQGSHNSTAITSNSTMTSNGLRGVQPAEDAPAISQWIQSRNNAAVSKKSEETA------ 284 
  Fly   285 GGSQSRVQSNV-ASISSPAVKATSDAAIPTPAERAERSRLRRNRNWILSRDV-----DEDAVVLV 343 
  Fly   344 SSGD-------------------EETTAADDGQTERRLSPDENQTLFT----------------- 372 
  Fly   373 ------------------------------YPPTG-----------TGG-----------LSITI 385 
  Fly   386 KDFMCLSKGSYLNDIIIDFYLRWLKNNIIPEEQRD----RTHIFSTFFHKRLTTRTNPRNTKQTA 446 
  Fly   447 AQKRHERVEKWTRNVNIFDKDFIIIPFNEQSHWILAIICYPNLRSPVVNNNNVQTTLSDDIPIKQ 511 
  Fly   512 PLILIFDSLAVTSRHRAIAILRDYLTCEH---------------KAKYPNALAHVFNKDNMPGHS 561 
  Fly   562 VEVPQQQNLTDCGLYLLQYVEQFFTK 587 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG12717 | NP_001285167.1 | BASP1 | 122..319 | CDD:283191 | 38/215 (18%) | 
| Peptidase_C48 | 396..585 | CDD:304959 | 52/207 (25%) | ||
| senp1 | XP_001343517.1 | Peptidase_C48 | <490..726 | CDD:304959 | 64/270 (24%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5160 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 71 | 1.000 | Inparanoid score | I5303 | 
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.950 | |||||