DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and si:dkey-21c19.3

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_001343517.1 Gene:si:dkey-21c19.3 ZFINID:ZDB-GENE-030131-6462 Length:729 Species:Danio rerio

Alignment Length:676 Identity:132/677 (19%)
Similarity:228/677 (34%) Gaps:257/677 (38%)


  Fly    57 TFKLPNLACRVQDLFFQMDLQIDESTTID-------CIEN-------AGGIIHLVVSVGFPISDN 107
            ||..|:.:...:.:.....|:.:.|.||.       |:|:       |.|  |   ||..|    
Zfish   137 TFVAPSSSVEWRTVTKSDSLRTEHSVTISKTSRRQVCMEHPPHEMYKANG--H---SVNLP---- 192

  Fly   108 IAETVAHAEEFYRKVHQSKASSADAAPPNAMAGEE--HSP-AVVKPSETAVANNGCQPAASATKG 169
                               :||.....|:...|..  |.| :::...||:        :..||..
Zfish   193 -------------------SSSTPKPSPSPRLGRSLYHRPQSILSSPETS--------SGKATYT 230

  Fly   170 KKHKKS------PCGSPGENNDGQVILSADQDANTNTKAKKQKKCH---IAKDNNGIQAASSHDN 225
            ..::|:      ....||.:|  :::.:..:.....:..:::|:.:   :...:.| |::..||.
Zfish   231 SLYEKTFPIRVVQSSLPGSSN--RLLRARARSTAQESVREEEKEVYRQLLVMVSEG-QSSFLHDG 292

  Fly   226 PSSSGNKQGSHNSTAITSNSTMTSNGLRGVQPAEDAPAISQWIQSRNNAAVSKKSEETA------ 284
            .|.|..:.....|:.::|:.::    |....||.....:|.:..|....:....|.:|:      
Zfish   293 SSHSSIRSHRDFSSFLSSSRSL----LHCASPAGSGAGVSSYGLSSPPPSPQPGSSQTSSALPSP 353

  Fly   285 GGSQSRVQSNV-ASISSPAVKATSDAAIPTPAERAERSRLRRNRNWILSRDV-----DEDAVVLV 343
            |.:.|..:..: |....|:.|.....:.|:||...:.|          |:|.     |.|:|:.|
Zfish   354 GAASSLAEPPLWAHDLEPSAKGPDVPSAPSPAALQDTS----------SQDTQSSAHDGDSVIFV 408

  Fly   344 SSGD-------------------EETTAADDGQTERRLSPDENQTLFT----------------- 372
            ....                   |.|:..|....|||...:|.:.|.:                 
Zfish   409 KEQQGKKPESSSVPCFQAELWIKELTSLYDSRARERRRLIEEQEALASQLLRQRLSGEGRASPAS 473

  Fly   373 ------------------------------YPPTG-----------TGG-----------LSITI 385
                                          :|...           .||           |:||.
Zfish   474 VELKVRVPLEKEVPIAAVIKKPQPIKEEPEFPELTEEMENDVSRALRGGSQDEILSEGFRLTITR 538

  Fly   386 KDFMCLSKGSYLNDIIIDFYLRWLKNNIIPEEQRD----RTHIFSTFFHKRLTTRTNPRNTKQTA 446
            ||...||..::|||.:|:||:     |::.|..:.    ..:.|:|||..:|      |::..:|
Zfish   539 KDLQTLSHLNWLNDEVINFYM-----NLLVERSKQPDLPSAYTFNTFFFPKL------RSSGYSA 592

  Fly   447 AQKRHERVEKWTRNVNIFDKDFIIIPFNEQSHWILAIICYPNLRSPVVNNNNVQTTLSDDIPIKQ 511
                   |.:||:.|:||..|.|::|.:...||.|:::.:.|                       
Zfish   593 -------VRRWTKKVDIFSVDLILVPVHLGVHWCLSVVDFRN----------------------- 627

  Fly   512 PLILIFDSLAVTSRHRAIAILRDYLTCEH---------------KAKYPNALAHVFNKDNMPGHS 561
            ..|..|||:. .:...|..||.:||..|.               |:|.||               
Zfish   628 KSITYFDSMG-GNNDEACRILLNYLKQESEDKKGQKMETSGWSLKSKRPN--------------- 676

  Fly   562 VEVPQQQNLTDCGLYLLQYVEQFFTK 587
             |:|||.|.:|||::..:|.| :.||
Zfish   677 -EIPQQMNGSDCGMFTCKYAE-YITK 700

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 38/216 (18%)
Peptidase_C48 396..585 CDD:304959 52/208 (25%)
si:dkey-21c19.3XP_001343517.1 Peptidase_C48 <490..726 CDD:304959 64/271 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.