DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12717 and senp7b

Sequence 1:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_005161832.1 Gene:senp7b ZFINID:ZDB-GENE-060531-45 Length:884 Species:Danio rerio

Alignment Length:656 Identity:172/657 (26%)
Similarity:261/657 (40%) Gaps:174/657 (26%)


  Fly   133 APPNAMAGEEHSPAVVKP-------SETAVANNGCQPAAS--ATKGKKHKKSPCGS-----PGEN 183
            ||...:...|...|...|       |||| .|....|.||  ::|.::..:|.|.:     |...
Zfish   243 APARHLRTSEERAASSVPVRKDPLTSETA-ENKSKDPFASFYSSKLRRKPQSFCKTYKRTKPSST 306

  Fly   184 NDGQVILSADQDANTNTKAKKQKKCHIAKDNNGIQAASSHDNPSSSGNKQGSHNSTAITSNSTM- 247
            .  .::||:| |...|............:.:.||:...:.:..||..|..|..::|.:...|.| 
Zfish   307 E--PIVLSSD-DEGANEVNDVSGGLQEQRISEGIRDTQTGNQKSSKTNVGGERSTTKVEVPSIME 368

  Fly   248 -------------TSNGL-----RGVQ-PAEDAPAISQWIQSRNNAAVSKKSEETA------GGS 287
                         .:||.     .|:. |.:||       ......|:|....:..      ||.
Zfish   369 LEFSRLHYDTIQAQANGTVVITDEGISIPLKDA-------DGEGEVAISISCSQLQMYGMWDGGL 426

  Fly   288 QSRVQSNVASISSPAVKATSDAAIPTPAERAERSRLRRNRN------------WILSRDVDEDAV 340
            .|  ..::.||:.....:.....:.....|..|..|....|            .:||..:|:..|
Zfish   427 AS--DGSLLSITEEPAPSLFFLMVSDAQARLLRKELSLQYNTHTSGQACPFVLLVLSGQLDDLRV 489

  Fly   341 VLVSS--------------------------------GDE-----ETTAADDGQ----------- 357
            .|::|                                |:.     .....|.||           
Zfish   490 ALLASLMDVIGLRYAQDSLSNPVSWADGLSRLLCHPRGEHFLSLLGQNCKDTGQDKAKENASGIK 554

  Fly   358 --TERR--LSPDENQT----LFTY-PPTGTGGLSITIKDFMCLSKGSYLNDIIIDFYLRWLKNNI 413
              |.||  .|..:.|:    |..| ||...||:::|.:|..||..|.:|||:||||||::|....
Zfish   555 EPTARRPLRSHSKPQSLPRRLIQYPPPPSKGGITVTTEDLECLKDGEFLNDVIIDFYLKYLLLER 619

  Fly   414 IPEEQRDRTHIFSTFFHKRLTTR--TNPRNTKQTAAQKRHERVEKWTRNVNIFDKDFIIIPFNEQ 476
            ..::..:|:||||:||:|:||.:  :.|..|..|:|.:||:||..|||:|:||.||::.||.|.:
Zfish   620 ADKDIAERSHIFSSFFYKQLTRKDTSGPEETGSTSAYRRHQRVRTWTRHVDIFSKDYLFIPVNHE 684

  Fly   477 SHWILAIICYPNLRSPVV-----------------------------------NNNNVQTTLSDD 506
            :||.|.:||:|.|..|.:                                   |.:.:..:.|.:
Zfish   685 AHWYLVLICFPALERPQIVEWRQKSSVSQDESQTTKERPSGESQRESSQQPKGNPSKINESRSHN 749

  Fly   507 IP------------IKQPLILIFDSLAVTSRHRAIAILRDYLTCEHKAKYPNALAHVFNKDNMPG 559
            :|            .|:|.|||.|||.::...|...:||:||..|.:.:  ......|:.:::.|
Zfish   750 LPDCTVHSCTKETICKRPCILIMDSLKLSYHQRTYTLLREYLQVEWEVR--KGSCRSFSNESITG 812

  Fly   560 HSVEVPQQQNLTDCGLYLLQYVEQFFTKPINDYTLPIKELSNWFDLLTVTKKREDIANLIKKLMN 624
            ....||.|.|.:|||||||||||.|...|:.|:.||:: |..||....|.|||||:..|:..|..
Zfish   813 SLCRVPLQDNSSDCGLYLLQYVESFLQNPVVDFALPLR-LDQWFPRSQVRKKREDLRELVLLLYR 876

  Fly   625 ESNQQR 630
            ...:.|
Zfish   877 RQTEPR 882

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 45/226 (20%)
Peptidase_C48 396..585 CDD:304959 82/238 (34%)
senp7bXP_005161832.1 Peptidase_C48 601..845 CDD:304959 84/246 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107335047
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000927
OrthoInspector 1 1.000 T128811
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46896
Phylome 1 0.910 0.933 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1602
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.