DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2540 and GCG1

DIOPT Version :9

Sequence 1:NP_572818.1 Gene:CG2540 / 32216 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_011090.3 Gene:GCG1 / 856910 SGDID:S000000965 Length:232 Species:Saccharomyces cerevisiae


Alignment Length:229 Identity:72/229 - (31%)
Similarity:104/229 - (45%) Gaps:50/229 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 DADVWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHSIDHRGIPERPGRVVTLLPGD------ 129
            ::.:|:.|||||::|....|..|....:.||.|||:|.|.||||.|..||||.||:|.:      
Yeast     5 NSGIWVLGYGSLIYKPPSHYTHRIPAIIHGFARRFWQSSTDHRGTPANPGRVATLIPYEDIIRQT 69

  Fly   130 -------------PAQDR----VYGVAYRIAASQKGAVLDHLDYREKNGYERCSLEFH-----EY 172
                         |.||.    ..||.|.|.......|.::|:.||:|||....:|.|     |:
Yeast    70 AFLKNVNLYSESAPIQDPDDLVTIGVVYYIPPEHAQEVREYLNVREQNGYTLHEVEVHLETNREH 134

  Fly   173 PTDGAEPIQVI--------------MYVATQANDSYAGDVWQVPCIARQIFSSAGPSGPNREYLF 223
            ..:..|.::.:              :|:.|..|:::.|.. .|...|:.|..|.||||.|.|||.
Yeast   135 EAELGEALEQLPRHNKSGKRVLLTSVYIGTIDNEAFVGPE-TVDETAKVIAVSHGPSGSNYEYLA 198

  Fly   224 NLAAAMDQLFP-----GAVDEH-LEELVACVKRY 251
            .|..|:.|: |     |.:.:| |..|:..|.:|
Yeast   199 KLEQALAQM-PIMKERGRITDHYLTALLETVNKY 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 71/224 (32%)
GCG1NP_011090.3 ChaC 8..231 CDD:398428 71/224 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344009
Domainoid 1 1.000 93 1.000 Domainoid score I1701
eggNOG 1 0.900 - - E1_COG3703
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H48696
Inparanoid 1 1.050 93 1.000 Inparanoid score I1514
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 1 1.000 - - otm46843
orthoMCL 1 0.900 - - OOG6_101165
Panther 1 1.100 - - LDO PTHR12192
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R197
SonicParanoid 1 1.000 - - X941
TreeFam 1 0.960 - -
1413.780

Return to query results.
Submit another query.