DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2540 and GCG1

Sequence 1:NP_572818.1 Gene:CG2540 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_011090.3 Gene:GCG1 SGDID:S000000965 Length:232 Species:Saccharomyces cerevisiae

Alignment Length:229 Identity:72/230 (31%)
Similarity:104/230 (45%) Gaps:50/230 (22%)


  Fly    71 DADVWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHSIDHRGIPERPGRVVTLLPGD------ 129
            ::.:|:.|||||::|....|..|....:.||.|||:|.|.||||.|..||||.||:|.:      
Yeast     5 NSGIWVLGYGSLIYKPPSHYTHRIPAIIHGFARRFWQSSTDHRGTPANPGRVATLIPYEDIIRQT 69

  Fly   130 -------------PAQDR----VYGVAYRIAASQKGAVLDHLDYREKNGYERCSLEFH-----EY 172
                         |.||.    ..||.|.|.......|.::|:.||:|||....:|.|     |:
Yeast    70 AFLKNVNLYSESAPIQDPDDLVTIGVVYYIPPEHAQEVREYLNVREQNGYTLHEVEVHLETNREH 134

  Fly   173 PTDGAEPIQVI--------------MYVATQANDSYAGDVWQVPCIARQIFSSAGPSGPNREYLF 223
            ..:..|.::.:              :|:.|..|:::.|.. .|...|:.|..|.||||.|.|||.
Yeast   135 EAELGEALEQLPRHNKSGKRVLLTSVYIGTIDNEAFVGPE-TVDETAKVIAVSHGPSGSNYEYLA 198

  Fly   224 NLAAAMDQLFP-----GAVDEH-LEELVACVKRY 251
            .|..|:.|: |     |.:.:| |..|:..|.:|
Yeast   199 KLEQALAQM-PIMKERGRITDHYLTALLETVNKY 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 71/225 (32%)
GCG1NP_011090.3 ChaC 8..231 CDD:282590 71/225 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C27546751
eggNOG 1 0.900 E1_COG3703
Hieranoid 1 1.000
Homologene 1 1.000 H48696
Inparanoid 1 1.050 93 1.000 Inparanoid score I1489
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001526
OrthoInspector 1 1.000 T634775
orthoMCL 1 0.900 OOG5_127651
Panther 1 1.100 O PTHR12192
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R197
TreeFam 1 0.960
1211.780

Return to query results.
Submit another query.