DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2540 and AT5G26220

Sequence 1:NP_572818.1 Gene:CG2540 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_197994.1 Gene:AT5G26220 AraportID:AT5G26220 Length:216 Species:Arabidopsis thaliana

Alignment Length:224 Identity:72/225 (32%)
Similarity:107/225 (48%) Gaps:35/225 (16%)


  Fly    74 VWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHSIDHRGIPERPGRVVTLLPGDPAQDRVYGV 138
            :|:||||||:|...|.:.::..|::..:||.|....|||||.||.|.|..||.....|  ..:|.
plant     3 LWVFGYGSLIWNPGFDFDEKLIGYIKDYKRVFDLACIDHRGTPEHPARTCTLEQSTGA--ICWGA 65

  Fly   139 AY--RIAASQKGAVLDHLDYREKNGYERCSLEFHEYPTDGAEPIQVIMYVATQANDSYAGDVWQV 201
            ||  |....::...:::|:.||.....:..:||:. ..|.:.||...:.|.|...|..:...:..
plant    66 AYCVRGGPEKEKLAMEYLERRECEYDSKTLVEFYT-ENDTSTPIVTGVIVFTSTPDKVSNKYYLG 129

  Fly   202 PC----IARQIFSSAGPSGPNREYLFNLAAAMDQLFPGAVDEHLEELVACVKRYIVE-------- 254
            |.    :||||.:::||.|.||||||.|..||..:      ||.||       |::|        
plant   130 PAPLEEMARQIATASGPCGNNREYLFKLEKAMFDI------EHEEE-------YVIELANEVRKQ 181

  Fly   255 -DEPQLIRHALLHEISGILEEEQLAEQAH 282
             |.|:.:: |||   ..|:....:..|||
plant   182 LDLPEEVK-ALL---KPIVSHVSVKSQAH 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 61/183 (33%)
AT5G26220NP_197994.1 GGCT_like 3..181 CDD:304619 63/194 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1238273at2759
OrthoInspector 1 1.000 T125371
orthoMCL 1 0.900 OOG5_127651
Panther 1 1.100 O PTHR12192
Phylome 1 0.910 0.600 Consistency score
65.920

Return to query results.
Submit another query.