DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2540 and AT4G31290

Sequence 1:NP_572818.1 Gene:CG2540 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_567871.1 Gene:AT4G31290 AraportID:AT4G31290 Length:227 Species:Arabidopsis thaliana

Alignment Length:198 Identity:66/199 (33%)
Similarity:109/199 (55%) Gaps:21/199 (11%)


  Fly    74 VWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHSIDHRGIPERPGRVVTLLPGDPAQDRV-YG 137
            :|:||||||||...|.|.::..||:.|:||.|....|||||.||.|.|..||   :.|::.: :|
plant     3 MWVFGYGSLVWNPGFHYDEKVLGFIKGYKRVFDLACIDHRGTPEHPARTCTL---EKAEEAICWG 64

  Fly   138 VAY--RIAASQKGAVLDHLDYREKNGYERCSLEFHEYPTDGAEPIQ-----VIMYVATQ---AND 192
            .|:  |....::...:::|:.||.....:.|::|  |..|  :|::     ||::.:|.   :|.
plant    65 TAFCVRGGPEKERLAMEYLERRECEYDLKTSVDF--YKED--DPLKPAVTGVIVFTSTPDKVSNK 125

  Fly   193 SYAGDVWQVPCIARQIFSSAGPSGPNREYLFNLAAAMDQLFPGAVDEHLEELVACVKRYIVEDEP 257
            .|.|.. .:..:||||.::.||.|.||:|||.|..||..:  |..::::.||...|::.:.|...
plant   126 YYLGPA-PLEDMARQIATANGPCGNNRDYLFLLEKAMHDI--GHEEDYVIELANEVRKVLAESST 187

  Fly   258 QLI 260
            :.:
plant   188 KKV 190

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 65/188 (35%)
AT4G31290NP_567871.1 GGCT_like 3..180 CDD:304619 65/187 (35%)
ChaC 4..187 CDD:226226 66/193 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1238273at2759
OrthoInspector 1 1.000 T125371
orthoMCL 1 0.900 OOG5_127651
Panther 1 1.100 O PTHR12192
Phylome 1 0.910 0.600 Consistency score
65.920

Return to query results.
Submit another query.