DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2540 and CHAC1

DIOPT Version :9

Sequence 1:NP_572818.1 Gene:CG2540 / 32216 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_024305813.1 Gene:CHAC1 / 79094 HGNCID:28680 Length:264 Species:Homo sapiens


Alignment Length:202 Identity:85/202 - (42%)
Similarity:110/202 - (54%) Gaps:15/202 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 DTENSNQLEPPAA----TDAD---VWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHSIDHRG 114
            :|..::|...|:|    .|.|   :||||||||||:.||.|.|.|.|||.|:.|||:|....|||
Human    51 NTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRG 115

  Fly   115 IPERPGRVVTLLPGDPAQDRVYGVAYRIAASQKGAVLDHLDYREK--NGYERCSLEFHEYPTDGA 177
            ..:.||||||||  :..:...:||||::...|....|.:|:.||.  .||:...:.|  ||.|..
Human   116 SDKMPGRVVTLL--EDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTF--YPQDAP 176

  Fly   178 -EPIQVIMYVATQANDSYAGDVWQVPCIARQIFSSAGPSGPNREYLFNLAAAMDQLFPGAVDEHL 241
             :|::.:.||||..|..|.|...: ..||.||.:..|.||.|.|||..||..|....|.|.||||
Human   177 DQPLKALAYVATPQNPGYLGPAPE-EAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHL 240

  Fly   242 EELVACV 248
            ..:|..|
Human   241 AAIVDAV 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 79/178 (44%)
CHAC1XP_024305813.1 ChaC 75..249 CDD:282590 79/178 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1238273at2759
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101165
Panther 1 1.100 - - O PTHR12192
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R197
SonicParanoid 1 1.000 - - X941
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.