| Sequence 1: | NP_572818.1 | Gene: | CG2540 / 32216 | FlyBaseID: | FBgn0030411 | Length: | 311 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_024305813.1 | Gene: | CHAC1 / 79094 | HGNCID: | 28680 | Length: | 264 | Species: | Homo sapiens |
| Alignment Length: | 202 | Identity: | 85/202 - (42%) |
|---|---|---|---|
| Similarity: | 110/202 - (54%) | Gaps: | 15/202 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 57 DTENSNQLEPPAA----TDAD---VWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHSIDHRG 114
Fly 115 IPERPGRVVTLLPGDPAQDRVYGVAYRIAASQKGAVLDHLDYREK--NGYERCSLEFHEYPTDGA 177
Fly 178 -EPIQVIMYVATQANDSYAGDVWQVPCIARQIFSSAGPSGPNREYLFNLAAAMDQLFPGAVDEHL 241
Fly 242 EELVACV 248 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG2540 | NP_572818.1 | ChaC | 74..251 | CDD:282590 | 79/178 (44%) |
| CHAC1 | XP_024305813.1 | ChaC | 75..249 | CDD:282590 | 79/178 (44%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1238273at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0001482 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 1 | 0.900 | - | - | OOG6_101165 | |
| Panther | 1 | 1.100 | - | - | O | PTHR12192 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R197 |
| SonicParanoid | 1 | 1.000 | - | - | X941 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 7 | 6.950 | |||||